BLASTX nr result
ID: Cephaelis21_contig00004626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004626 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136668.1| PREDICTED: probable sugar phosphate/phosphat... 56 3e-06 >ref|XP_004136668.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290-like [Cucumis sativus] gi|449519701|ref|XP_004166873.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g10290-like [Cucumis sativus] Length = 307 Score = 56.2 bits (134), Expect = 3e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 147 VTNYFSSVLF*GKSNPLQRMKSMSQFFGISTLSIVFCVSVVVGNISLKY 1 + +YFS V+F K P+Q +KS SQFF I+TL +VFC SVV GN+SL+Y Sbjct: 53 ILSYFSIVVF--KIVPIQMLKSRSQFFKIATLGLVFCASVVGGNVSLRY 99