BLASTX nr result
ID: Cephaelis21_contig00004620
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004620 (830 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI15940.3| unnamed protein product [Vitis vinifera] 74 5e-11 ref|XP_002278953.1| PREDICTED: U-box domain-containing protein 4... 74 5e-11 emb|CAN60531.1| hypothetical protein VITISV_005582 [Vitis vinifera] 74 5e-11 >emb|CBI15940.3| unnamed protein product [Vitis vinifera] Length = 1052 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -3 Query: 240 RSDSSLVEGLRGLLLHFVRIHDSEFVSMIKAHHLMTIFRHQLVFTSKARVKQLASVGLKS 61 RS S L EGL GLLLHF + D + VS++K H LM IFR QL F K RVKQLA++GLK+ Sbjct: 777 RSSSCLEEGLLGLLLHFTQSPDPQTVSVVKEHSLMNIFREQLNFPLKPRVKQLAALGLKN 836 Query: 60 LSE 52 LSE Sbjct: 837 LSE 839 >ref|XP_002278953.1| PREDICTED: U-box domain-containing protein 43-like [Vitis vinifera] Length = 1029 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -3 Query: 240 RSDSSLVEGLRGLLLHFVRIHDSEFVSMIKAHHLMTIFRHQLVFTSKARVKQLASVGLKS 61 RS S L EGL GLLLHF + D + VS++K H LM IFR QL F K RVKQLA++GLK+ Sbjct: 777 RSSSCLEEGLLGLLLHFTQSPDPQTVSVVKEHSLMNIFREQLNFPLKPRVKQLAALGLKN 836 Query: 60 LSE 52 LSE Sbjct: 837 LSE 839 >emb|CAN60531.1| hypothetical protein VITISV_005582 [Vitis vinifera] Length = 1105 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/63 (61%), Positives = 46/63 (73%) Frame = -3 Query: 240 RSDSSLVEGLRGLLLHFVRIHDSEFVSMIKAHHLMTIFRHQLVFTSKARVKQLASVGLKS 61 RS S L EGL GLLLHF + D + VS++K H LM IFR QL F K RVKQLA++GLK+ Sbjct: 777 RSSSCLEEGLLGLLLHFTQSPDXQTVSVVKEHSLMNIFREQLNFPLKPRVKQLAALGLKN 836 Query: 60 LSE 52 LSE Sbjct: 837 LSE 839