BLASTX nr result
ID: Cephaelis21_contig00004607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00004607 (873 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510707.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 ref|XP_002521740.1| conserved hypothetical protein [Ricinus comm... 57 4e-06 ref|XP_002307807.1| predicted protein [Populus trichocarpa] gi|2... 57 4e-06 gb|ABK93970.1| unknown [Populus trichocarpa] 57 4e-06 ref|XP_002310110.1| predicted protein [Populus trichocarpa] gi|2... 57 6e-06 >ref|XP_002510707.1| conserved hypothetical protein [Ricinus communis] gi|223551408|gb|EEF52894.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 298 LYVLQLSKALTGDNRKDLMRKLPKFIYDEEKALE 399 +Y Q+SKAL G +RKDLMRKLPKFIYDEEKALE Sbjct: 90 VYAPQISKALAGTDRKDLMRKLPKFIYDEEKALE 123 >ref|XP_002521740.1| conserved hypothetical protein [Ricinus communis] gi|223539131|gb|EEF40727.1| conserved hypothetical protein [Ricinus communis] Length = 155 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 298 LYVLQLSKALTGDNRKDLMRKLPKFIYDEEKALE 399 +Y Q+SKAL G +RKDLMRKLPKFIYDEEKALE Sbjct: 78 IYAPQISKALAGADRKDLMRKLPKFIYDEEKALE 111 >ref|XP_002307807.1| predicted protein [Populus trichocarpa] gi|222857256|gb|EEE94803.1| predicted protein [Populus trichocarpa] Length = 176 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 298 LYVLQLSKALTGDNRKDLMRKLPKFIYDEEKALE 399 +Y Q+SKAL G +RKDLMRKLPKFIYDEEKALE Sbjct: 99 VYAPQISKALAGTDRKDLMRKLPKFIYDEEKALE 132 >gb|ABK93970.1| unknown [Populus trichocarpa] Length = 176 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 298 LYVLQLSKALTGDNRKDLMRKLPKFIYDEEKALE 399 +Y Q+SKAL G +RKDLMRKLPKFIYDEEKALE Sbjct: 99 VYAPQISKALAGTDRKDLMRKLPKFIYDEEKALE 132 >ref|XP_002310110.1| predicted protein [Populus trichocarpa] gi|222853013|gb|EEE90560.1| predicted protein [Populus trichocarpa] Length = 164 Score = 57.0 bits (136), Expect = 6e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 298 LYVLQLSKALTGDNRKDLMRKLPKFIYDEEKALE 399 +Y Q+SKAL G +RKDLMRKLPKFIYDEEKALE Sbjct: 87 VYAPQISKALAGADRKDLMRKLPKFIYDEEKALE 120