BLASTX nr result
ID: Cephaelis21_contig00003437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003437 (457 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001236432.1| allene oxide synthase [Glycine max] gi|82795... 77 6e-22 ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796... 75 3e-21 gb|ABC68414.1| cytochrome P450 monooxygenase CYP74A3 [Glycine max] 75 3e-21 dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] 75 5e-21 gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] 75 5e-21 >ref|NP_001236432.1| allene oxide synthase [Glycine max] gi|82795997|gb|ABB91776.1| allene oxide synthase [Glycine max] Length = 524 Score = 77.0 bits (188), Expect(2) = 6e-22 Identities = 34/42 (80%), Positives = 39/42 (92%) Frame = +3 Query: 3 KLLKYVVWSNGPETESPSVNNKQCAGKDFVVLVTRLLVAEFF 128 KLLK+V+WSNGPETESP++ NKQCAGKDFV LV+RLLV EFF Sbjct: 454 KLLKHVLWSNGPETESPTIGNKQCAGKDFVTLVSRLLVVEFF 495 Score = 52.0 bits (123), Expect(2) = 6e-22 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 218 EFFRRYDSFDIEVGKSVLGDSVTITSLRRASF 313 EFF RYDSF+I+VG S LG SVTITSL+RASF Sbjct: 493 EFFLRYDSFEIQVGTSPLGSSVTITSLKRASF 524 >ref|NP_001236445.1| allene oxide synthase [Glycine max] gi|82796032|gb|ABB91777.1| allene oxide synthase [Glycine max] gi|169786998|gb|ACA79943.1| chloroplast allene oxide synthase [Glycine max] Length = 519 Score = 74.7 bits (182), Expect(2) = 3e-21 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 KLLKYVVWSNGPETESPSVNNKQCAGKDFVVLVTRLLVAEFF 128 KLLK+V+WSNGPETESP++ NKQCAGKDFV LV+RL V EFF Sbjct: 449 KLLKHVLWSNGPETESPTLGNKQCAGKDFVTLVSRLFVVEFF 490 Score = 52.0 bits (123), Expect(2) = 3e-21 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 218 EFFRRYDSFDIEVGKSVLGDSVTITSLRRASF 313 EFF RYDSF+I+VG S LG SVTITSL+RASF Sbjct: 488 EFFLRYDSFEIQVGTSPLGSSVTITSLKRASF 519 >gb|ABC68414.1| cytochrome P450 monooxygenase CYP74A3 [Glycine max] Length = 193 Score = 74.7 bits (182), Expect(2) = 3e-21 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +3 Query: 3 KLLKYVVWSNGPETESPSVNNKQCAGKDFVVLVTRLLVAEFF 128 KLLK+V+WSNGPETESP++ NKQCAGKDFV LV+RL V EFF Sbjct: 123 KLLKHVLWSNGPETESPTLGNKQCAGKDFVTLVSRLFVVEFF 164 Score = 52.0 bits (123), Expect(2) = 3e-21 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +2 Query: 218 EFFRRYDSFDIEVGKSVLGDSVTITSLRRASF 313 EFF RYDSF+I+VG S LG SVTITSL+RASF Sbjct: 162 EFFLRYDSFEIQVGTSPLGSSVTITSLKRASF 193 >dbj|BAK52267.1| allene oxide synthase [Ipomoea nil] Length = 519 Score = 74.7 bits (182), Expect(2) = 5e-21 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 3 KLLKYVVWSNGPETESPSVNNKQCAGKDFVVLVTRLLVAEFF 128 +LL +V+WSNGPETESP+VNNKQCAGKDFVVLV+RL+V E F Sbjct: 449 ELLSHVLWSNGPETESPTVNNKQCAGKDFVVLVSRLMVVELF 490 Score = 51.2 bits (121), Expect(2) = 5e-21 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 218 EFFRRYDSFDIEVGKSVLGDSVTITSLRRASF 313 E F RYDSFDIEVG S LG SVT+TSL+RASF Sbjct: 488 ELFLRYDSFDIEVGTSPLGASVTVTSLKRASF 519 >gb|ADN92996.2| allene oxide synthase AOS [Ipomoea nil] Length = 376 Score = 74.7 bits (182), Expect(2) = 5e-21 Identities = 33/42 (78%), Positives = 39/42 (92%) Frame = +3 Query: 3 KLLKYVVWSNGPETESPSVNNKQCAGKDFVVLVTRLLVAEFF 128 +LL +V+WSNGPETESP+VNNKQCAGKDFVVLV+RL+V E F Sbjct: 306 ELLSHVLWSNGPETESPTVNNKQCAGKDFVVLVSRLMVVELF 347 Score = 51.2 bits (121), Expect(2) = 5e-21 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +2 Query: 218 EFFRRYDSFDIEVGKSVLGDSVTITSLRRASF 313 E F RYDSFDIEVG S LG SVT+TSL+RASF Sbjct: 345 ELFLRYDSFDIEVGTSPLGASVTVTSLKRASF 376