BLASTX nr result
ID: Cephaelis21_contig00003154
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00003154 (2269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523824.1| conserved hypothetical protein [Ricinus comm... 67 2e-08 ref|XP_002877338.1| hypothetical protein ARALYDRAFT_484859 [Arab... 63 3e-07 ref|NP_190024.1| late embryogenesis abundant hydroxyproline-rich... 62 9e-07 ref|XP_003538110.1| PREDICTED: uncharacterized protein LOC100782... 60 2e-06 ref|XP_004140159.1| PREDICTED: uncharacterized protein LOC101218... 59 6e-06 >ref|XP_002523824.1| conserved hypothetical protein [Ricinus communis] gi|223536912|gb|EEF38550.1| conserved hypothetical protein [Ricinus communis] Length = 184 Score = 67.0 bits (162), Expect = 2e-08 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 1/75 (1%) Frame = +1 Query: 1870 LPTAGHDVVLTVHITSLNLTEIQFSTT-MSIHYGDSLLSFVRVETRF*AARSCNLFHLPA 2046 LP D++LTVH+T+ N+T I +S+T MSI Y SLL +VE ARSC L L A Sbjct: 50 LPVLDADLLLTVHVTNPNITSIHYSSTSMSIFYDGSLLGSAQVEAGSQPARSCKLLRLQA 109 Query: 2047 QFNGMELAHHLRNFW 2091 + +G++LAHH F+ Sbjct: 110 RLDGLQLAHHASKFF 124 >ref|XP_002877338.1| hypothetical protein ARALYDRAFT_484859 [Arabidopsis lyrata subsp. lyrata] gi|297323176|gb|EFH53597.1| hypothetical protein ARALYDRAFT_484859 [Arabidopsis lyrata subsp. lyrata] Length = 186 Score = 63.2 bits (152), Expect = 3e-07 Identities = 33/75 (44%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +1 Query: 1870 LPTAGHDVVLTVHITSLNLTEIQFS-TTMSIHYGDSLLSFVRVETRF*AARSCNLFHLPA 2046 LP +++LTVH+T+ N+ I +S TTM+I Y ++L V+ ARSC L LPA Sbjct: 52 LPVLDAELMLTVHVTNPNIAAIHYSSTTMTILYDGTVLGSAEVKAGSQPARSCQLLRLPA 111 Query: 2047 QFNGMELAHHLRNFW 2091 + +GMELA H R F+ Sbjct: 112 RLDGMELAQHARQFF 126 >ref|NP_190024.1| late embryogenesis abundant hydroxyproline-rich glycoprotein [Arabidopsis thaliana] gi|7529772|emb|CAB86916.1| putative protein [Arabidopsis thaliana] gi|332644377|gb|AEE77898.1| late embryogenesis abundant hydroxyproline-rich glycoprotein [Arabidopsis thaliana] Length = 186 Score = 61.6 bits (148), Expect = 9e-07 Identities = 32/75 (42%), Positives = 47/75 (62%), Gaps = 1/75 (1%) Frame = +1 Query: 1870 LPTAGHDVVLTVHITSLNLTEIQFSTT-MSIHYGDSLLSFVRVETRF*AARSCNLFHLPA 2046 LP +++LTVH+T+ N+ I +S+T M+I Y ++L V+ ARSC L LPA Sbjct: 52 LPVLDAELMLTVHVTNPNIAAIHYSSTKMTILYDGTVLGSAEVKAGSQPARSCQLLRLPA 111 Query: 2047 QFNGMELAHHLRNFW 2091 + +GMELA H R F+ Sbjct: 112 RLDGMELAQHARQFF 126 >ref|XP_003538110.1| PREDICTED: uncharacterized protein LOC100782945 [Glycine max] Length = 191 Score = 60.5 bits (145), Expect = 2e-06 Identities = 32/73 (43%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = +1 Query: 1873 PTAGHDVVLTVHITSLNLTEIQFSTT-MSIHYGDSLLSFVRVETRF*AARSCNLFHLPAQ 2049 P +V+LTVH+T+ N+ I +S+T MSI Y SLL +V+ RSC L LPA+ Sbjct: 51 PLLDAEVLLTVHVTNPNIAPIHYSSTSMSIFYQGSLLGSAQVQAGSQPPRSCQLLRLPAR 110 Query: 2050 FNGMELAHHLRNF 2088 + +ELAHH F Sbjct: 111 LHALELAHHATRF 123 >ref|XP_004140159.1| PREDICTED: uncharacterized protein LOC101218134 [Cucumis sativus] gi|449481051|ref|XP_004156067.1| PREDICTED: uncharacterized LOC101218134 [Cucumis sativus] Length = 183 Score = 58.9 bits (141), Expect = 6e-06 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 1/73 (1%) Frame = +1 Query: 1873 PTAGHDVVLTVHITSLNLTEIQFSTT-MSIHYGDSLLSFVRVETRF*AARSCNLFHLPAQ 2049 P +++LTVH+T+ N+ I +S+T MSI Y SLL +V+ RSC + LPA+ Sbjct: 50 PVVDTELILTVHVTNPNVAPIHYSSTAMSIFYEGSLLGSAQVDAGSQQPRSCQVLRLPAR 109 Query: 2050 FNGMELAHHLRNF 2088 +G++LAHH F Sbjct: 110 LDGLKLAHHGSRF 122