BLASTX nr result
ID: Cephaelis21_contig00002943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002943 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521451.1| polypeptide deformylase, putative [Ricinus c... 72 6e-11 ref|XP_002276964.1| PREDICTED: peptide deformylase 1B, chloropla... 69 3e-10 ref|XP_004158319.1| PREDICTED: peptide deformylase 1B, chloropla... 68 9e-10 ref|NP_001234441.1| peptide deformylase 1B, chloroplastic [Solan... 66 3e-09 ref|XP_002300047.1| peptide deformylase [Populus trichocarpa] gi... 64 1e-08 >ref|XP_002521451.1| polypeptide deformylase, putative [Ricinus communis] gi|223539350|gb|EEF40941.1| polypeptide deformylase, putative [Ricinus communis] Length = 282 Score = 71.6 bits (174), Expect = 6e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 2 ERGEGEEVVLVNPKINRCSKKVIPYNEGCLSFPKIYADV 118 ERGEGEE+VL+NP++N+ SKK++P+NEGCLSFP IYADV Sbjct: 152 ERGEGEEIVLINPRLNKYSKKIVPFNEGCLSFPGIYADV 190 >ref|XP_002276964.1| PREDICTED: peptide deformylase 1B, chloroplastic [Vitis vinifera] gi|296087647|emb|CBI34903.3| unnamed protein product [Vitis vinifera] Length = 275 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = +2 Query: 2 ERGEGEEVVLVNPKINRCSKKVIPYNEGCLSFPKIYADVD 121 ERGEGEE+VLVNP++N+ SKK++ +NEGCLSFP IYADV+ Sbjct: 145 ERGEGEEIVLVNPRVNKYSKKIVLFNEGCLSFPGIYADVE 184 >ref|XP_004158319.1| PREDICTED: peptide deformylase 1B, chloroplastic-like [Cucumis sativus] Length = 273 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +2 Query: 2 ERGEGEEVVLVNPKINRCSKKVIPYNEGCLSFPKIYADVD 121 ERGEGEE+VLVNPK+ R SKK + +NEGCLSFP IYADV+ Sbjct: 144 ERGEGEEIVLVNPKVYRYSKKTVLFNEGCLSFPMIYADVE 183 >ref|NP_001234441.1| peptide deformylase 1B, chloroplastic [Solanum lycopersicum] gi|17433052|sp|Q9FV54.1|DEF1B_SOLLC RecName: Full=Peptide deformylase 1B, chloroplastic; Short=PDF 1B; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|11320950|gb|AAG33972.1| peptide deformylase-like protein [Solanum lycopersicum] Length = 279 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = +2 Query: 2 ERGEGEEVVLVNPKINRCSKKVIPYNEGCLSFPKIYADV 118 ERGEGEE+VLVNP+++R S+++IPY EGCLSFP I+ DV Sbjct: 149 ERGEGEEIVLVNPRVSRYSRRIIPYEEGCLSFPMIHGDV 187 >ref|XP_002300047.1| peptide deformylase [Populus trichocarpa] gi|222847305|gb|EEE84852.1| peptide deformylase [Populus trichocarpa] Length = 258 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +2 Query: 2 ERGEGEEVVLVNPKINRCSKKVIPYNEGCLSFPKIYADV 118 E GEG+E+VLVNP++N+ SKK + +NEGCLSFP IYADV Sbjct: 129 EHGEGDEIVLVNPRVNKYSKKTVLFNEGCLSFPGIYADV 167