BLASTX nr result
ID: Cephaelis21_contig00002934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002934 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus com... 57 1e-06 ref|XP_002304537.1| cation proton exchanger [Populus trichocarpa... 57 2e-06 ref|XP_002463597.1| hypothetical protein SORBIDRAFT_01g002640 [S... 55 4e-06 ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus com... 55 8e-06 ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana... 55 8e-06 >ref|XP_002509895.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549794|gb|EEF51282.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 419 LNKKTDCPELGPVGNLLTAPDFSTTASVLVVQQY 318 LN K +CPELGP GNLLT+ DF+T+ASVLVVQQY Sbjct: 745 LNGKAECPELGPAGNLLTSHDFTTSASVLVVQQY 778 >ref|XP_002304537.1| cation proton exchanger [Populus trichocarpa] gi|222841969|gb|EEE79516.1| cation proton exchanger [Populus trichocarpa] Length = 806 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/56 (53%), Positives = 38/56 (67%) Frame = -1 Query: 419 LNKKTDCPELGPVGNLLTAPDFSTTASVLVVQQYLRELSAGALESLRVEDSTAESS 252 LN K +CPELGPVG+LL +PDF+T ASVLV+QQ+ + S RV + AE S Sbjct: 748 LNVKVECPELGPVGHLLISPDFTTLASVLVMQQHAS--PGSVVGSTRVTEMPAEDS 801 >ref|XP_002463597.1| hypothetical protein SORBIDRAFT_01g002640 [Sorghum bicolor] gi|241917451|gb|EER90595.1| hypothetical protein SORBIDRAFT_01g002640 [Sorghum bicolor] Length = 819 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 419 LNKKTDCPELGPVGNLLTAPDFSTTASVLVVQQY 318 L +K+DCPELGPVG+ L P+FSTTASVLVVQ+Y Sbjct: 745 LVEKSDCPELGPVGSYLATPEFSTTASVLVVQRY 778 >ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549793|gb|EEF51281.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -1 Query: 419 LNKKTDCPELGPVGNLLTAPDFSTTASVLVVQQYLRELS 303 LN+ +CPELGPVG+LL +FSTTASVLV+QQY ++S Sbjct: 748 LNRWNECPELGPVGSLLATSNFSTTASVLVIQQYDSQVS 786 >ref|NP_188390.2| cation/H(+) antiporter 19 [Arabidopsis thaliana] gi|75311599|sp|Q9LUN4.1|CHX19_ARATH RecName: Full=Cation/H(+) antiporter 19; AltName: Full=Protein CATION/H+ EXCHANGER 19; Short=AtCHX19 gi|9294151|dbj|BAB02053.1| Na+/H+ exchangeing protein-like [Arabidopsis thaliana] gi|61658327|gb|AAX49547.1| cation/H+ exchanger [Arabidopsis thaliana] gi|332642462|gb|AEE75983.1| cation/H(+) antiporter 19 [Arabidopsis thaliana] Length = 800 Score = 54.7 bits (130), Expect = 8e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 419 LNKKTDCPELGPVGNLLTAPDFSTTASVLVVQQY 318 L K TDCPELGPVG LL++ +FSTTASVLVVQ Y Sbjct: 739 LVKSTDCPELGPVGRLLSSSEFSTTASVLVVQGY 772