BLASTX nr result
ID: Cephaelis21_contig00002843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002843 (1509 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi... 202 1e-49 ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 202 1e-49 ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 201 4e-49 ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5... 201 5e-49 ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ri... 200 7e-49 >ref|NP_001237603.1| ubiquitin carrier protein 4 [Glycine max] gi|6066285|gb|AAF03236.1|AF180143_1 ubiquitin carrier protein 4 [Glycine max] Length = 183 Score = 202 bits (515), Expect = 1e-49 Identities = 95/98 (96%), Positives = 95/98 (96%) Frame = +3 Query: 864 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 1043 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 1044 FEAFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVK 1157 FE FLPQLLLYPNPSDPLNGEAAALMMRDRA YE RVK Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVK 140 >ref|XP_003548669.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 202 bits (515), Expect = 1e-49 Identities = 95/98 (96%), Positives = 95/98 (96%) Frame = +3 Query: 864 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 1043 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 1044 FEAFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVK 1157 FE FLPQLLLYPNPSDPLNGEAAALMMRDRA YE RVK Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRATYEQRVK 140 >ref|XP_003552403.1| PREDICTED: ubiquitin-conjugating enzyme E2 5-like [Glycine max] Length = 183 Score = 201 bits (511), Expect = 4e-49 Identities = 94/98 (95%), Positives = 95/98 (96%) Frame = +3 Query: 864 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 1043 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 1044 FEAFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVK 1157 FE FLPQLLLYPNPSDPLNGEAAALMMRDR +YE RVK Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRPSYEQRVK 140 >ref|XP_002276343.1| PREDICTED: ubiquitin-conjugating enzyme E2 5 [Vitis vinifera] gi|147789691|emb|CAN74060.1| hypothetical protein VITISV_024680 [Vitis vinifera] gi|297745317|emb|CBI40397.3| unnamed protein product [Vitis vinifera] Length = 184 Score = 201 bits (510), Expect = 5e-49 Identities = 92/98 (93%), Positives = 95/98 (96%) Frame = +3 Query: 864 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 1043 PYHGGVW++RVELPDAYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 1044 FEAFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVK 1157 FE FLPQLLLYPNPSDPLNGEAAALMMRDR AYE RVK Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRTAYEQRVK 140 >ref|XP_002511883.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] gi|223549063|gb|EEF50552.1| ubiquitin-conjugating enzyme h, putative [Ricinus communis] Length = 183 Score = 200 bits (509), Expect = 7e-49 Identities = 92/98 (93%), Positives = 95/98 (96%) Frame = +3 Query: 864 PYHGGVWKVRVELPDAYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 1043 PYHGGVW++RVELPDAYPYKSPSIGF+NKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV Sbjct: 43 PYHGGVWRIRVELPDAYPYKSPSIGFVNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNV 102 Query: 1044 FEAFLPQLLLYPNPSDPLNGEAAALMMRDRAAYELRVK 1157 FE FLPQLLLYPNPSDPLNGEAAALMMRDR AYE RVK Sbjct: 103 FEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYEQRVK 140