BLASTX nr result
ID: Cephaelis21_contig00002725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002725 (407 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002454009.1| hypothetical protein SORBIDRAFT_04g022990 [S... 62 6e-08 ref|XP_003575159.1| PREDICTED: uncharacterized protein LOC100846... 60 2e-07 ref|XP_002328796.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_004133729.1| PREDICTED: COX assembly mitochondrial protei... 59 5e-07 gb|EEC67867.1| hypothetical protein OsI_35493 [Oryza sativa Indi... 59 5e-07 >ref|XP_002454009.1| hypothetical protein SORBIDRAFT_04g022990 [Sorghum bicolor] gi|241933840|gb|EES06985.1| hypothetical protein SORBIDRAFT_04g022990 [Sorghum bicolor] Length = 104 Score = 61.6 bits (148), Expect = 6e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 79 MHPPLTLHRHPMCAEIIKEFQKCHLD 2 MHPPLTLHRHPMCAEII+EFQKCHLD Sbjct: 1 MHPPLTLHRHPMCAEIIEEFQKCHLD 26 >ref|XP_003575159.1| PREDICTED: uncharacterized protein LOC100846021 [Brachypodium distachyon] Length = 82 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 79 MHPPLTLHRHPMCAEIIKEFQKCHLD 2 MHPPLTLHRHPMC EII+EFQKCHLD Sbjct: 1 MHPPLTLHRHPMCREIIEEFQKCHLD 26 >ref|XP_002328796.1| predicted protein [Populus trichocarpa] gi|222839094|gb|EEE77445.1| predicted protein [Populus trichocarpa] Length = 87 Score = 58.9 bits (141), Expect = 4e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -2 Query: 79 MHPPLTLHRHPMCAEIIKEFQKCHLD 2 MHPPLTLHRHPMC EII++FQKCHLD Sbjct: 1 MHPPLTLHRHPMCVEIIEQFQKCHLD 26 >ref|XP_004133729.1| PREDICTED: COX assembly mitochondrial protein 2 homolog [Cucumis sativus] gi|449511587|ref|XP_004163998.1| PREDICTED: COX assembly mitochondrial protein 2 homolog [Cucumis sativus] Length = 78 Score = 58.5 bits (140), Expect = 5e-07 Identities = 22/26 (84%), Positives = 26/26 (100%) Frame = -2 Query: 79 MHPPLTLHRHPMCAEIIKEFQKCHLD 2 MHPPLTLH+HPMCAEII++FQKCH+D Sbjct: 1 MHPPLTLHKHPMCAEIIEQFQKCHID 26 >gb|EEC67867.1| hypothetical protein OsI_35493 [Oryza sativa Indica Group] Length = 459 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 94 TTGWIMHPPLTLHRHPMCAEIIKEFQKCHLD 2 +T MHPPLTLHRHPMCAEII+ FQKCH+D Sbjct: 372 STSLEMHPPLTLHRHPMCAEIIEAFQKCHVD 402