BLASTX nr result
ID: Cephaelis21_contig00002681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002681 (586 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164055.1| PREDICTED: indole-3-glycerol phosphate synth... 76 5e-12 ref|XP_004144552.1| PREDICTED: indole-3-glycerol phosphate synth... 76 5e-12 emb|CBI28465.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_002265275.1| PREDICTED: indole-3-glycerol phosphate synth... 73 4e-11 ref|XP_002532209.1| tryptophan biosynthesis protein, trpc, putat... 72 7e-11 >ref|XP_004164055.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Length = 411 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +3 Query: 3 TFKVDISNTQHLLREERGQKIRERGITVVGESGLFTPADIAYVQESGV 146 TF+VDISNT+ LL ERGQKIRE+ + +VGESGLFTP DIAYVQE+GV Sbjct: 335 TFEVDISNTKKLLEGERGQKIREKNVIIVGESGLFTPDDIAYVQEAGV 382 >ref|XP_004144552.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Length = 411 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/48 (75%), Positives = 42/48 (87%) Frame = +3 Query: 3 TFKVDISNTQHLLREERGQKIRERGITVVGESGLFTPADIAYVQESGV 146 TF+VDISNT+ LL ERGQKIRE+ + +VGESGLFTP DIAYVQE+GV Sbjct: 335 TFEVDISNTKKLLEGERGQKIREKNVIIVGESGLFTPDDIAYVQEAGV 382 >emb|CBI28465.3| unnamed protein product [Vitis vinifera] Length = 363 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 3 TFKVDISNTQHLLREERGQKIRERGITVVGESGLFTPADIAYVQESGV 146 TF+VDISNT+ LL ERG+ IR++ I VVGESGLFTPAD+AYVQE+GV Sbjct: 287 TFEVDISNTKKLLEGERGEIIRQKDIIVVGESGLFTPADVAYVQEAGV 334 >ref|XP_002265275.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic [Vitis vinifera] Length = 396 Score = 72.8 bits (177), Expect = 4e-11 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +3 Query: 3 TFKVDISNTQHLLREERGQKIRERGITVVGESGLFTPADIAYVQESGV 146 TF+VDISNT+ LL ERG+ IR++ I VVGESGLFTPAD+AYVQE+GV Sbjct: 320 TFEVDISNTKKLLEGERGEIIRQKDIIVVGESGLFTPADVAYVQEAGV 367 >ref|XP_002532209.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] gi|223528105|gb|EEF30178.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] Length = 389 Score = 72.0 bits (175), Expect = 7e-11 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = +3 Query: 3 TFKVDISNTQHLLREERGQKIRERGITVVGESGLFTPADIAYVQESGV 146 TF+VDISNT+ LL ERGQ I+++GI VVGESGLFTP DIAYV E+GV Sbjct: 312 TFEVDISNTRKLLEGERGQLIQQKGIIVVGESGLFTPEDIAYVHEAGV 359