BLASTX nr result
ID: Cephaelis21_contig00002678
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002678 (714 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164055.1| PREDICTED: indole-3-glycerol phosphate synth... 87 4e-15 ref|XP_004144552.1| PREDICTED: indole-3-glycerol phosphate synth... 87 4e-15 ref|XP_003545642.1| PREDICTED: indole-3-glycerol phosphate synth... 86 1e-14 ref|XP_003519406.1| PREDICTED: indole-3-glycerol phosphate synth... 84 3e-14 ref|XP_002532209.1| tryptophan biosynthesis protein, trpc, putat... 84 3e-14 >ref|XP_004164055.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Length = 411 Score = 86.7 bits (213), Expect = 4e-15 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +1 Query: 1 GINNQNLETFKIDISITRHLLREESGQKIRERGIIVVGESGLFTPADIAYVQESGV 168 GINN+NLETF++DIS T+ LL E GQKIRE+ +I+VGESGLFTP DIAYVQE+GV Sbjct: 327 GINNRNLETFEVDISNTKKLLEGERGQKIREKNVIIVGESGLFTPDDIAYVQEAGV 382 >ref|XP_004144552.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Cucumis sativus] Length = 411 Score = 86.7 bits (213), Expect = 4e-15 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +1 Query: 1 GINNQNLETFKIDISITRHLLREESGQKIRERGIIVVGESGLFTPADIAYVQESGV 168 GINN+NLETF++DIS T+ LL E GQKIRE+ +I+VGESGLFTP DIAYVQE+GV Sbjct: 327 GINNRNLETFEVDISNTKKLLEGERGQKIREKNVIIVGESGLFTPDDIAYVQEAGV 382 >ref|XP_003545642.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Glycine max] Length = 392 Score = 85.5 bits (210), Expect = 1e-14 Identities = 42/56 (75%), Positives = 49/56 (87%) Frame = +1 Query: 1 GINNQNLETFKIDISITRHLLREESGQKIRERGIIVVGESGLFTPADIAYVQESGV 168 GINN+NLETF++DISIT+ LL E G+ I ERGII+VGESGLFTP DIAYVQE+GV Sbjct: 307 GINNRNLETFELDISITKKLLEGERGKIIHERGIIMVGESGLFTPDDIAYVQEAGV 362 >ref|XP_003519406.1| PREDICTED: indole-3-glycerol phosphate synthase, chloroplastic-like [Glycine max] Length = 393 Score = 84.0 bits (206), Expect = 3e-14 Identities = 41/56 (73%), Positives = 49/56 (87%) Frame = +1 Query: 1 GINNQNLETFKIDISITRHLLREESGQKIRERGIIVVGESGLFTPADIAYVQESGV 168 GINN+NLETF++DISIT+ LL E G+ IRERGI +VGESGLFTP DIAYV+E+GV Sbjct: 308 GINNRNLETFELDISITKKLLEGERGKIIRERGITMVGESGLFTPDDIAYVKEAGV 363 >ref|XP_002532209.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] gi|223528105|gb|EEF30178.1| tryptophan biosynthesis protein, trpc, putative [Ricinus communis] Length = 389 Score = 84.0 bits (206), Expect = 3e-14 Identities = 41/56 (73%), Positives = 48/56 (85%) Frame = +1 Query: 1 GINNQNLETFKIDISITRHLLREESGQKIRERGIIVVGESGLFTPADIAYVQESGV 168 GINN+NLETF++DIS TR LL E GQ I+++GIIVVGESGLFTP DIAYV E+GV Sbjct: 304 GINNRNLETFEVDISNTRKLLEGERGQLIQQKGIIVVGESGLFTPEDIAYVHEAGV 359