BLASTX nr result
ID: Cephaelis21_contig00002510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00002510 (766 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529794.1| hypothetical protein RCOM_0251410 [Ricinus c... 71 2e-15 emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] 57 5e-15 emb|CAN60890.1| hypothetical protein VITISV_011880 [Vitis vinifera] 59 5e-15 emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] 59 5e-15 emb|CAN80491.1| hypothetical protein VITISV_042679 [Vitis vinifera] 60 1e-14 >ref|XP_002529794.1| hypothetical protein RCOM_0251410 [Ricinus communis] gi|223530738|gb|EEF32608.1| hypothetical protein RCOM_0251410 [Ricinus communis] Length = 295 Score = 70.9 bits (172), Expect(2) = 2e-15 Identities = 27/59 (45%), Positives = 45/59 (76%) Frame = +1 Query: 388 ATRLSRLEFHKFSGEDFRSWLYRCEQFFEVDDTSSDTKVKLVAMHLESRTLQWYQVFME 564 A+R +++EF +F GED WL++ ++FF++D T S+++VKL +HLE R LQW+Q F++ Sbjct: 108 ASRFTKVEFPRFGGEDVEGWLFKYDRFFQIDQTPSNSQVKLALIHLEGRALQWHQTFIK 166 Score = 37.4 bits (85), Expect(2) = 2e-15 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +2 Query: 605 DYIRNLVSRFGNALYDDPMGELMSLKQKRSVEEYQQEFEKLLNR 736 DY+R + RF Y DPM +L L Q SV +Y +EF+ L ++ Sbjct: 178 DYVRAIKCRFRVRTYKDPMADLKMLVQIGSVSDYLEEFDVLSHK 221 >emb|CAN76793.1| hypothetical protein VITISV_026680 [Vitis vinifera] Length = 1469 Score = 57.4 bits (137), Expect(2) = 5e-15 Identities = 24/54 (44%), Positives = 34/54 (62%) Frame = +1 Query: 391 TRLSRLEFHKFSGEDFRSWLYRCEQFFEVDDTSSDTKVKLVAMHLESRTLQWYQ 552 TR RL+F KF+GED W+YR +QFF T+ +V L + H+E + L W+Q Sbjct: 86 TRAVRLDFPKFNGEDPNGWVYRADQFFNYHQTNPHHRVLLASFHMEGKALVWFQ 139 Score = 49.7 bits (117), Expect(2) = 5e-15 Identities = 24/56 (42%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +2 Query: 602 QDYIRNLVSRFGNALYDDPMGELMSLKQKRSVEEYQQEFEKLLNRVE-LPEVYAIS 766 + ++R L +RFG++ Y+DPM L+ LKQ +VE+Y+ +FE L N++ L E Y +S Sbjct: 151 EGFVRALQTRFGSSPYEDPMEALIRLKQTSTVEDYKSQFEALSNQLRGLAESYKLS 206 >emb|CAN60890.1| hypothetical protein VITISV_011880 [Vitis vinifera] Length = 1378 Score = 58.5 bits (140), Expect(2) = 5e-15 Identities = 24/62 (38%), Positives = 39/62 (62%) Frame = +1 Query: 400 SRLEFHKFSGEDFRSWLYRCEQFFEVDDTSSDTKVKLVAMHLESRTLQWYQVFMEAISGR 579 ++++F KF+G WL R E FFEVD T + +V+L A+HLE + +QW+Q +++ Sbjct: 127 TKVDFPKFNGCGLDGWLLRVEYFFEVDRTPPEARVRLAALHLEGKAIQWHQGYIKTRGNE 186 Query: 580 LY 585 Y Sbjct: 187 AY 188 Score = 48.5 bits (114), Expect(2) = 5e-15 Identities = 20/54 (37%), Positives = 37/54 (68%) Frame = +2 Query: 605 DYIRNLVSRFGNALYDDPMGELMSLKQKRSVEEYQQEFEKLLNRVELPEVYAIS 766 +Y+ L +RFG ++DDP+ +L +L+Q S++ Y EF++L R ++ E +A+S Sbjct: 193 EYVIALNARFGQHVFDDPIADLRNLRQTGSLQSYMDEFDELYPRADIKESHALS 246 >emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] Length = 1371 Score = 59.3 bits (142), Expect(2) = 5e-15 Identities = 24/62 (38%), Positives = 39/62 (62%) Frame = +1 Query: 400 SRLEFHKFSGEDFRSWLYRCEQFFEVDDTSSDTKVKLVAMHLESRTLQWYQVFMEAISGR 579 ++++F KF+G WL R E FFEVD T + +V+L A+HLE + +QW+Q +++ Sbjct: 75 TKVDFPKFNGGGLDGWLLRVEYFFEVDRTPPEARVRLAALHLEGKAIQWHQGYIKTRGNE 134 Query: 580 LY 585 Y Sbjct: 135 AY 136 Score = 47.8 bits (112), Expect(2) = 5e-15 Identities = 19/54 (35%), Positives = 37/54 (68%) Frame = +2 Query: 605 DYIRNLVSRFGNALYDDPMGELMSLKQKRSVEEYQQEFEKLLNRVELPEVYAIS 766 +Y+ L +RFG +++DP+ +L +L+Q S++ Y EF++L R ++ E +A+S Sbjct: 141 EYVIALNARFGQHVFBDPIADLRNLRQTGSLQSYMDEFDELYPRADIKESHALS 194 >emb|CAN80491.1| hypothetical protein VITISV_042679 [Vitis vinifera] Length = 1412 Score = 60.1 bits (144), Expect(2) = 1e-14 Identities = 24/62 (38%), Positives = 39/62 (62%) Frame = +1 Query: 400 SRLEFHKFSGEDFRSWLYRCEQFFEVDDTSSDTKVKLVAMHLESRTLQWYQVFMEAISGR 579 ++++F KF+G WL R E FFEVD T + +V+L A+HLE + +QW+Q +++ Sbjct: 75 TKVDFXKFNGXGLDGWLLRVEYFFEVDRTPPEARVRLAALHLEGKAIQWHQGYIKTRGNE 134 Query: 580 LY 585 Y Sbjct: 135 AY 136 Score = 45.8 bits (107), Expect(2) = 1e-14 Identities = 19/49 (38%), Positives = 34/49 (69%) Frame = +2 Query: 620 LVSRFGNALYDDPMGELMSLKQKRSVEEYQQEFEKLLNRVELPEVYAIS 766 L +RFG ++DDP+ +L +L+Q S++ Y EF++L R ++ E +A+S Sbjct: 146 LNARFGQHVFDDPIADLRNLRQTGSLQSYMDEFDELYPRADIKESHALS 194