BLASTX nr result
ID: Cephaelis21_contig00001928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001928 (542 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529258.1| mta/sah nucleosidase, putative [Ricinus comm... 130 2e-28 ref|XP_002313743.1| predicted protein [Populus trichocarpa] gi|2... 129 4e-28 ref|XP_002305481.1| predicted protein [Populus trichocarpa] gi|1... 126 2e-27 ref|XP_002868864.1| ATMTN1 [Arabidopsis lyrata subsp. lyrata] gi... 123 2e-26 ref|NP_195591.1| methylthioadenosine nucleosidase 1 [Arabidopsis... 123 2e-26 >ref|XP_002529258.1| mta/sah nucleosidase, putative [Ricinus communis] gi|223531294|gb|EEF33136.1| mta/sah nucleosidase, putative [Ricinus communis] Length = 266 Score = 130 bits (326), Expect = 2e-28 Identities = 66/89 (74%), Positives = 73/89 (82%) Frame = +1 Query: 274 SLVGVDSVGTVSASLVTYASIQVLQPDLVINXXXXXXXXXXXXSIGDVFVASDVAFHDRR 453 S +GVDSVGT+SASLVTYASIQ LQPDL+IN SIGDV++ SDVAFHDRR Sbjct: 82 STLGVDSVGTISASLVTYASIQALQPDLIINAGTSGGFKAKGASIGDVYLVSDVAFHDRR 141 Query: 454 IPIPVFDLYGVGLKQAFSTPNLLKELSLK 540 IPIPVFDLYGVGL+QA STPNLLKEL+LK Sbjct: 142 IPIPVFDLYGVGLRQACSTPNLLKELNLK 170 >ref|XP_002313743.1| predicted protein [Populus trichocarpa] gi|222850151|gb|EEE87698.1| predicted protein [Populus trichocarpa] Length = 263 Score = 129 bits (323), Expect = 4e-28 Identities = 65/89 (73%), Positives = 73/89 (82%) Frame = +1 Query: 274 SLVGVDSVGTVSASLVTYASIQVLQPDLVINXXXXXXXXXXXXSIGDVFVASDVAFHDRR 453 S +GVDSVGT+SASLVTYA+IQ LQPDL+IN SI DVF+ASDVAFHDRR Sbjct: 79 STLGVDSVGTISASLVTYAAIQALQPDLIINAGTAGSFKVKGASISDVFLASDVAFHDRR 138 Query: 454 IPIPVFDLYGVGLKQAFSTPNLLKELSLK 540 IPIPVFDLYGVG +Q+FSTPNLLKEL+LK Sbjct: 139 IPIPVFDLYGVGSRQSFSTPNLLKELNLK 167 >ref|XP_002305481.1| predicted protein [Populus trichocarpa] gi|118481001|gb|ABK92454.1| unknown [Populus trichocarpa] gi|222848445|gb|EEE85992.1| predicted protein [Populus trichocarpa] Length = 263 Score = 126 bits (316), Expect = 2e-27 Identities = 63/87 (72%), Positives = 70/87 (80%) Frame = +1 Query: 280 VGVDSVGTVSASLVTYASIQVLQPDLVINXXXXXXXXXXXXSIGDVFVASDVAFHDRRIP 459 +GVDSVGT+SASLVTYA+IQ LQPDL+IN I DVF+ SDVAFHDRRIP Sbjct: 81 LGVDSVGTISASLVTYAAIQALQPDLIINAGTAGGFKVKGACISDVFLVSDVAFHDRRIP 140 Query: 460 IPVFDLYGVGLKQAFSTPNLLKELSLK 540 IPVFDLYGVGL+Q FSTPNLLKEL+LK Sbjct: 141 IPVFDLYGVGLRQCFSTPNLLKELNLK 167 >ref|XP_002868864.1| ATMTN1 [Arabidopsis lyrata subsp. lyrata] gi|297314700|gb|EFH45123.1| ATMTN1 [Arabidopsis lyrata subsp. lyrata] Length = 266 Score = 123 bits (308), Expect = 2e-26 Identities = 59/87 (67%), Positives = 71/87 (81%) Frame = +1 Query: 280 VGVDSVGTVSASLVTYASIQVLQPDLVINXXXXXXXXXXXXSIGDVFVASDVAFHDRRIP 459 +G+DSVGTV ASL+T+ASIQ L+PD++IN +IGDVF+ SDV FHDRRIP Sbjct: 84 LGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIP 143 Query: 460 IPVFDLYGVGLKQAFSTPNLLKELSLK 540 IP+FDLYGVGL+QAFSTPNLLKEL+LK Sbjct: 144 IPMFDLYGVGLRQAFSTPNLLKELNLK 170 >ref|NP_195591.1| methylthioadenosine nucleosidase 1 [Arabidopsis thaliana] gi|75213779|sp|Q9T0I8.1|MTN1_ARATH RecName: Full=5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase 1; Short=AtMTN1; AltName: Full=5'-methylthioadenosine nucleosidase; Short=MTA nucleosidase; AltName: Full=MTA/SAH nucleosidase 1; Short=AtMTAN1; AltName: Full=S-adenosylhomocysteine nucleosidase; Short=AdoHcy nucleosidase; Short=SAH nucleosidase; Short=SRH nucleosidase gi|118137896|pdb|2H8G|A Chain A, 5'-Methylthioadenosine Nucleosidase From Arabidopsis Thaliana gi|118137897|pdb|2H8G|B Chain B, 5'-Methylthioadenosine Nucleosidase From Arabidopsis Thaliana gi|171848871|pdb|2QSU|A Chain A, Structure Of Arabidopsis Thaliana 5'-Methylthioadenosine Nucleosidase In Apo Form gi|171848872|pdb|2QSU|B Chain B, Structure Of Arabidopsis Thaliana 5'-Methylthioadenosine Nucleosidase In Apo Form gi|171848873|pdb|2QTG|A Chain A, Crystal Structure Of Arabidopsis Thaliana 5'- Methylthioadenosine Nucleosidase In Complex With 5'- Methylthiotubercidin gi|171848874|pdb|2QTG|B Chain B, Crystal Structure Of Arabidopsis Thaliana 5'- Methylthioadenosine Nucleosidase In Complex With 5'- Methylthiotubercidin gi|171848875|pdb|2QTT|A Chain A, Crystal Structure Of Arabidopsis Thaliana 5'- Methylthioadenosine Nucleosidase In Complex With Formycin A gi|171848876|pdb|2QTT|B Chain B, Crystal Structure Of Arabidopsis Thaliana 5'- Methylthioadenosine Nucleosidase In Complex With Formycin A gi|299856755|pdb|3LGS|A Chain A, A. Thaliana Mta Nucleosidase In Complex With S-Adenosylhomocysteine gi|299856756|pdb|3LGS|B Chain B, A. Thaliana Mta Nucleosidase In Complex With S-Adenosylhomocysteine gi|299856757|pdb|3LGS|C Chain C, A. Thaliana Mta Nucleosidase In Complex With S-Adenosylhomocysteine gi|299856758|pdb|3LGS|D Chain D, A. Thaliana Mta Nucleosidase In Complex With S-Adenosylhomocysteine gi|13878069|gb|AAK44112.1|AF370297_1 unknown protein [Arabidopsis thaliana] gi|4490332|emb|CAB38614.1| putative protein [Arabidopsis thaliana] gi|7270863|emb|CAB80543.1| putative protein [Arabidopsis thaliana] gi|23296997|gb|AAN13219.1| unknown protein [Arabidopsis thaliana] gi|332661576|gb|AEE86976.1| methylthioadenosine nucleosidase 1 [Arabidopsis thaliana] Length = 267 Score = 123 bits (308), Expect = 2e-26 Identities = 59/87 (67%), Positives = 71/87 (81%) Frame = +1 Query: 280 VGVDSVGTVSASLVTYASIQVLQPDLVINXXXXXXXXXXXXSIGDVFVASDVAFHDRRIP 459 +G+DSVGTV ASL+T+ASIQ L+PD++IN +IGDVF+ SDV FHDRRIP Sbjct: 85 LGIDSVGTVPASLITFASIQALKPDIIINAGTCGGFKVKGANIGDVFLVSDVVFHDRRIP 144 Query: 460 IPVFDLYGVGLKQAFSTPNLLKELSLK 540 IP+FDLYGVGL+QAFSTPNLLKEL+LK Sbjct: 145 IPMFDLYGVGLRQAFSTPNLLKELNLK 171