BLASTX nr result
ID: Cephaelis21_contig00001874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001874 (448 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 97 1e-18 gb|AAK08208.1|AF320905_1 metallothionein-like protein [Citrus un... 95 7e-18 gb|ABL67648.1| putative metallothionein-like protein [Citrus hyb... 94 1e-17 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 94 2e-17 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 94 2e-17 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 97.4 bits (241), Expect = 1e-18 Identities = 46/66 (69%), Positives = 48/66 (72%), Gaps = 2/66 (3%) Frame = +1 Query: 16 MSDKCGNCDCADKSQCVKKGTSYSADFXXXXXXXXXXIVMDV-GGAENDG-CKCGPSCAC 189 MS CGNCDCADKSQCVKKG+SY+AD IVMDV GAENDG CKCGPSC C Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAENDGKCKCGPSCTC 60 Query: 190 VDCTCG 207 VDC CG Sbjct: 61 VDCGCG 66 >gb|AAK08208.1|AF320905_1 metallothionein-like protein [Citrus unshiu] gi|12830832|gb|AAK08209.1|AF320906_1 metallothionein-like protein [Citrus unshiu] gi|3308982|dbj|BAA31562.1| metallothionein-like protein [Citrus unshiu] gi|158936952|dbj|BAF91493.1| metallothionein type 3 [Citrus unshiu] Length = 68 Score = 94.7 bits (234), Expect = 7e-18 Identities = 43/66 (65%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = +1 Query: 16 MSDKCGNCDCADKSQCVKKGTSYSADF-XXXXXXXXXXIVMDVGGAENDG-CKCGPSCAC 189 MSD CGNCDCAD+SQCVKKG+SY+ADF +VMDV AE +G CKCGP+CAC Sbjct: 1 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCAC 60 Query: 190 VDCTCG 207 V+CTCG Sbjct: 61 VNCTCG 66 >gb|ABL67648.1| putative metallothionein-like protein [Citrus hybrid cultivar] Length = 68 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/66 (65%), Positives = 50/66 (75%), Gaps = 2/66 (3%) Frame = +1 Query: 16 MSDKCGNCDCADKSQCVKKGTSYSADF-XXXXXXXXXXIVMDVGGAENDG-CKCGPSCAC 189 MSD CGNCDCAD+SQCVKKG+SY+ADF +VMDV AE +G CKCGP+CAC Sbjct: 1 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCAC 60 Query: 190 VDCTCG 207 V+CTCG Sbjct: 61 VNCTCG 66 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/65 (64%), Positives = 46/65 (70%), Gaps = 1/65 (1%) Frame = +1 Query: 16 MSDKCGNCDCADKSQCVKKGTSYSADFXXXXXXXXXXIVMDVGGAENDG-CKCGPSCACV 192 MS CGNCDCADKSQCVKKG+SY+AD I+MDV AE+DG CKCG SC CV Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHDGKCKCGASCTCV 60 Query: 193 DCTCG 207 CTCG Sbjct: 61 TCTCG 65 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 93.6 bits (231), Expect = 2e-17 Identities = 42/65 (64%), Positives = 48/65 (73%), Gaps = 1/65 (1%) Frame = +1 Query: 16 MSDKCGNCDCADKSQCVKKGTSYSADFXXXXXXXXXXIVMDVGGAENDG-CKCGPSCACV 192 MSD CGNCDCADK+QCVKKG+SY+AD +VMD AENDG CKCGPSC+C Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADI-IETEKSIMTVVMDAPAAENDGKCKCGPSCSCT 59 Query: 193 DCTCG 207 +CTCG Sbjct: 60 NCTCG 64