BLASTX nr result
ID: Cephaelis21_contig00001648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001648 (2092 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ03719.1| hypothetical protein (mitochondrion) [Oryza sativ... 99 4e-18 gb|AAR91194.1| hypothetical protein (mitochondrion) [Zea mays] 98 8e-18 ref|YP_004237259.1| cytochrome c biogenesis FN (mitochondrion) [... 83 3e-13 ref|XP_002535315.1| conserved hypothetical protein [Ricinus comm... 83 3e-13 gb|AFR34318.1| cytochrome c biogenesis FN (mitochondrion) [Glyci... 82 4e-13 >gb|AEZ03719.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group] gi|374277713|gb|AEZ03818.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group] Length = 160 Score = 99.0 bits (245), Expect = 4e-18 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = -3 Query: 677 MQGGYIADIGSCGTGFDSASGSVRTKKFRTKGSELADRKREKNKAMPRAESI 522 MQGG IADIGSCGTGFDSASGSVRTKKFRTKGSELADRK EKNKAMPRA SI Sbjct: 1 MQGGCIADIGSCGTGFDSASGSVRTKKFRTKGSELADRKEEKNKAMPRAPSI 52 >gb|AAR91194.1| hypothetical protein (mitochondrion) [Zea mays] Length = 160 Score = 98.2 bits (243), Expect = 8e-18 Identities = 49/52 (94%), Positives = 49/52 (94%) Frame = -3 Query: 677 MQGGYIADIGSCGTGFDSASGSVRTKKFRTKGSELADRKREKNKAMPRAESI 522 MQGG IADIGSCGTGFDSASGSVRTKKFRTKGSELADRK EKNKAMPRA SI Sbjct: 1 MQGGCIADIGSCGTGFDSASGSVRTKKFRTKGSELADRKGEKNKAMPRAPSI 52 >ref|YP_004237259.1| cytochrome c biogenesis FN (mitochondrion) [Ricinus communis] gi|322394266|gb|ADW96023.1| cytochrome c biogenesis FN (mitochondrion) [Ricinus communis] Length = 598 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 580 DPFVRNFFVRTEPLAESNPVPQDPISAIYPPCIYVGDVSTNSRFPI 717 DPFVRNFFVRTEPLAESNPVPQDPISAI+PPCIY GDV++ F + Sbjct: 243 DPFVRNFFVRTEPLAESNPVPQDPISAIHPPCIYAGDVASAMGFSL 288 >ref|XP_002535315.1| conserved hypothetical protein [Ricinus communis] gi|223523473|gb|EEF27070.1| conserved hypothetical protein [Ricinus communis] Length = 416 Score = 82.8 bits (203), Expect = 3e-13 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = +1 Query: 580 DPFVRNFFVRTEPLAESNPVPQDPISAIYPPCIYVGDVSTNSRFPI 717 DPFVRNFFVRTEPLAESNPVPQDPISAI+PPCIY GDV++ F + Sbjct: 61 DPFVRNFFVRTEPLAESNPVPQDPISAIHPPCIYAGDVASAMGFSL 106 >gb|AFR34318.1| cytochrome c biogenesis FN (mitochondrion) [Glycine max] Length = 578 Score = 82.4 bits (202), Expect = 4e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +1 Query: 580 DPFVRNFFVRTEPLAESNPVPQDPISAIYPPCIYVGDVSTNSRF 711 DPFVRNFFVRTEPLAESNPVPQDPISAI+PPCIY GDV++ F Sbjct: 244 DPFVRNFFVRTEPLAESNPVPQDPISAIHPPCIYAGDVASAMGF 287