BLASTX nr result
ID: Cephaelis21_contig00001639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00001639 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004159725.1| PREDICTED: LOW QUALITY PROTEIN: rac-like GTP... 70 1e-10 ref|XP_004146153.1| PREDICTED: rac-like GTP-binding protein ARAC... 70 1e-10 gb|AAO11654.1| putative ROP family GTPase [Brassica napus] 70 1e-10 gb|AAB38780.1| Rho1Ps homolog [Arabidopsis thaliana] 70 1e-10 gb|AAK31299.1| Rac-like GTPase 1 [Nicotiana tabacum] 70 1e-10 >ref|XP_004159725.1| PREDICTED: LOW QUALITY PROTEIN: rac-like GTP-binding protein ARAC1-like [Cucumis sativus] Length = 197 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 144 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 242 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 33 >ref|XP_004146153.1| PREDICTED: rac-like GTP-binding protein ARAC1-like [Cucumis sativus] Length = 197 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 144 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 242 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 33 >gb|AAO11654.1| putative ROP family GTPase [Brassica napus] Length = 197 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 144 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 242 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 33 >gb|AAB38780.1| Rho1Ps homolog [Arabidopsis thaliana] Length = 198 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 144 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 242 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 33 >gb|AAK31299.1| Rac-like GTPase 1 [Nicotiana tabacum] Length = 197 Score = 70.5 bits (171), Expect = 1e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +3 Query: 144 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 242 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT Sbjct: 1 MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPT 33