BLASTX nr result
ID: Cephaelis21_contig00000608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00000608 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI98634.1| hypothetical protein 111018.21 [Coffea canephora] 91 1e-16 ref|XP_002510372.1| conserved hypothetical protein [Ricinus comm... 62 5e-08 gb|AAD15492.1| hypothetical protein [Arabidopsis thaliana] 62 6e-08 ref|XP_002282793.1| PREDICTED: uncharacterized protein LOC100247... 61 8e-08 gb|EEC79568.1| hypothetical protein OsI_20718 [Oryza sativa Indi... 60 2e-07 >gb|AEI98634.1| hypothetical protein 111018.21 [Coffea canephora] Length = 302 Score = 90.5 bits (223), Expect = 1e-16 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +2 Query: 2 KDIMRPALSVREGIEIVISGGMSIPKILNIVDVQSILSPRVGKFAIPQV 148 KDIMRP LSVREGIEIVISGGMSIPKIL IVDVQSILSPRVGKFA+PQV Sbjct: 254 KDIMRPNLSVREGIEIVISGGMSIPKILTIVDVQSILSPRVGKFAVPQV 302 >ref|XP_002510372.1| conserved hypothetical protein [Ricinus communis] gi|223551073|gb|EEF52559.1| conserved hypothetical protein [Ricinus communis] Length = 267 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +2 Query: 2 KDIMRPALSVREGIEIVISGGMSIPKILNIVDVQSILSPRVGKF 133 KDIMRP LSVREGIEI+ISGGMS+P+IL +D Q+I + R+ K+ Sbjct: 219 KDIMRPNLSVREGIEIIISGGMSVPQILTTMDAQAIPAARLSKY 262 >gb|AAD15492.1| hypothetical protein [Arabidopsis thaliana] Length = 129 Score = 61.6 bits (148), Expect = 6e-08 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +2 Query: 2 KDIMRPALSVREGIEIVISGGMSIPKILNIVDVQSILSPRVGKFAIPQV 148 KDI+RP LSVREGIEIVISGGMSIP +L +D ++I VG FA+P V Sbjct: 81 KDIIRPNLSVREGIEIVISGGMSIPHMLTTLDSETIHRSVVGTFAMPPV 129 >ref|XP_002282793.1| PREDICTED: uncharacterized protein LOC100247211 [Vitis vinifera] gi|302142483|emb|CBI19686.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/48 (60%), Positives = 37/48 (77%) Frame = +2 Query: 5 DIMRPALSVREGIEIVISGGMSIPKILNIVDVQSILSPRVGKFAIPQV 148 DI+RP LSVREGIEIVISGGMS+P+IL +D Q+I + R+G +V Sbjct: 217 DILRPNLSVREGIEIVISGGMSVPQILTTIDAQAIPASRIGNLVAAKV 264 >gb|EEC79568.1| hypothetical protein OsI_20718 [Oryza sativa Indica Group] Length = 273 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/42 (66%), Positives = 36/42 (85%) Frame = +2 Query: 2 KDIMRPALSVREGIEIVISGGMSIPKILNIVDVQSILSPRVG 127 KD++RP LSVREGIEIV+SGGMS+P+IL+ +D Q+IL R G Sbjct: 228 KDVIRPNLSVREGIEIVVSGGMSMPQILSTLDPQTILGDRTG 269