BLASTX nr result
ID: Catharanthus23_contig00040979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00040979 (320 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago ... 66 4e-09 ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago ... 56 6e-06 >ref|XP_003615432.1| hypothetical protein MTR_5g067940 [Medicago truncatula] gi|355516767|gb|AES98390.1| hypothetical protein MTR_5g067940 [Medicago truncatula] Length = 69 Score = 66.2 bits (160), Expect = 4e-09 Identities = 41/63 (65%), Positives = 42/63 (66%), Gaps = 2/63 (3%) Frame = -1 Query: 320 ATDLIGLSLGMETY*VITFKFRETPELIKGAILSQIQFSTNTNKG--SENEKGIGAETQR 147 ATDLIGLSLGMETY V TFKFRET EL G F NK SEN+K IGAETQ Sbjct: 7 ATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENKKRIGAETQW 66 Query: 146 KLF 138 KLF Sbjct: 67 KLF 69 >ref|XP_003605622.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|357471517|ref|XP_003606043.1| hypothetical protein MTR_4g051230 [Medicago truncatula] gi|358349395|ref|XP_003638723.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355504658|gb|AES85861.1| hypothetical protein MTR_141s0027 [Medicago truncatula] gi|355506677|gb|AES87819.1| hypothetical protein MTR_4g035030 [Medicago truncatula] gi|355507098|gb|AES88240.1| hypothetical protein MTR_4g051230 [Medicago truncatula] Length = 95 Score = 55.8 bits (133), Expect = 6e-06 Identities = 35/60 (58%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = -1 Query: 320 ATDLIGLSLGMETY*VITFKFRETPELIKGAILSQIQFSTNTNKG--SENEKGIGAETQR 147 ATDLIGLSLGMETY V TFKFRET EL G F NK SEN+K IG R Sbjct: 7 ATDLIGLSLGMETYQVKTFKFRETLELKMGNPEPNPSFRKQINKSLESENQKRIGGGVSR 66