BLASTX nr result
ID: Catharanthus23_contig00040867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00040867 (308 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009002249.1| RNA polymerase beta' subunit (chloroplast) [... 58 1e-06 gb|AHH30432.1| RNA polymerase beta (chloroplast) [Bartsia inaequ... 55 7e-06 gb|AGL45327.1| RpoC1 (chloroplast) [Sesamum indicum] 55 7e-06 ref|YP_004935657.1| rpoC1 gene product (chloroplast) [Sesamum in... 55 7e-06 ref|YP_008964025.1| RNA polymerase beta' subunit 1 [Ajuga reptan... 55 1e-05 gb|EPS73618.1| hypothetical protein M569_01139, partial [Genlise... 55 1e-05 >ref|YP_009002249.1| RNA polymerase beta' subunit (chloroplast) [Pinguicula ehlersiae] gi|575882131|emb|CDL78805.1| RNA polymerase beta' subunit (chloroplast) [Pinguicula ehlersiae] Length = 687 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 W LDQ+VI SRET IE+ Y+SL CYEIYGH+L + IK Sbjct: 613 WHLDQRVIASRETPIEVHYESLGTCYEIYGHYLIVRSIK 651 >gb|AHH30432.1| RNA polymerase beta (chloroplast) [Bartsia inaequalis] Length = 679 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 WRLDQ+VI SRET IE+ Y+SL YEIYGH+L + IK Sbjct: 605 WRLDQRVIASRETPIEVHYESLGTYYEIYGHYLIVRSIK 643 >gb|AGL45327.1| RpoC1 (chloroplast) [Sesamum indicum] Length = 687 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 WRLDQ+VI SRET IE+ Y+SL YEIYGH+L + IK Sbjct: 613 WRLDQRVIASRETPIEVHYESLGTYYEIYGHYLIVRSIK 651 >ref|YP_004935657.1| rpoC1 gene product (chloroplast) [Sesamum indicum] gi|347448286|gb|AEO92697.1| RNA polymerase beta' subunit (chloroplast) [Sesamum indicum] Length = 691 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 WRLDQ+VI SRET IE+ Y+SL YEIYGH+L + IK Sbjct: 617 WRLDQRVIASRETPIEVHYESLGTYYEIYGHYLIVRSIK 655 >ref|YP_008964025.1| RNA polymerase beta' subunit 1 [Ajuga reptans] gi|558697184|gb|AHA84939.1| RNA polymerase beta' subunit 1 [Ajuga reptans] Length = 680 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 WRLDQ+VI SRET IE+ Y+SL YEIYGH+L + IK Sbjct: 606 WRLDQRVIASRETPIEVHYESLGNYYEIYGHYLIVRSIK 644 >gb|EPS73618.1| hypothetical protein M569_01139, partial [Genlisea aurea] Length = 422 Score = 55.1 bits (131), Expect = 1e-05 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -3 Query: 258 WRLDQQVIVSRETLIEIDYKSLAPCYEIYGHHLTITRIK 142 WRLDQ+VI RET +E+ Y+S+ CYEIYGH+L + +K Sbjct: 348 WRLDQRVIALRETPVEVHYESVGTCYEIYGHYLIVRSLK 386