BLASTX nr result
ID: Catharanthus23_contig00040756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00040756 (365 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB46747.1| Tetratricopeptide repeat protein 7B [Morus notabi... 57 3e-06 >gb|EXB46747.1| Tetratricopeptide repeat protein 7B [Morus notabilis] Length = 718 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 95 SGLLNEAKGLHKEAIKAFERALDIDPAHVPS 3 +GLLNEAKGLH+EA+KAF +ALD+DP HVPS Sbjct: 613 AGLLNEAKGLHQEALKAFRKALDVDPTHVPS 643