BLASTX nr result
ID: Catharanthus23_contig00040507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00040507 (271 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008081324.1| hypothetical chloroplast RF1 (chloroplast) [... 55 1e-05 >ref|YP_008081324.1| hypothetical chloroplast RF1 (chloroplast) [Catharanthus roseus] gi|474452135|gb|AGI51203.1| hypothetical chloroplast RF1 (chloroplast) [Catharanthus roseus] Length = 1748 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/41 (58%), Positives = 28/41 (68%) Frame = +3 Query: 3 RLSWSTIEKTHSNKFDNYWVYSXXXXXXXXXXXXELRNRIE 125 ++SWSTIEKTHSN+FDNYWV+S E RNRIE Sbjct: 374 KISWSTIEKTHSNQFDNYWVFSNNINIKGNNINKEFRNRIE 414