BLASTX nr result
ID: Catharanthus23_contig00039851
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00039851 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY04600.1| Cc-nbs-lrr resistance-like protein [Theobroma cacao] 60 4e-07 >gb|EOY04600.1| Cc-nbs-lrr resistance-like protein [Theobroma cacao] Length = 1350 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/60 (48%), Positives = 41/60 (68%) Frame = -2 Query: 264 ALSEQVQNRSNLRSLTIWGYSELESLP*WLGKLQNLQILKLELCGKLKHLPSSDALLQLS 85 +L EQ+Q+ S L+ L IW + +E+LP WLG L +LQ LK+ C KL LPS+ A+ QL+ Sbjct: 1251 SLPEQLQHLSALKRLEIWSFDGVEALPDWLGNLSSLQSLKIHQCEKLMCLPSAQAMQQLT 1310