BLASTX nr result
ID: Catharanthus23_contig00039847
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00039847 (314 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS59346.1| hypothetical protein M569_15462, partial [Genlise... 58 1e-06 >gb|EPS59346.1| hypothetical protein M569_15462, partial [Genlisea aurea] Length = 367 Score = 57.8 bits (138), Expect = 1e-06 Identities = 32/72 (44%), Positives = 40/72 (55%), Gaps = 2/72 (2%) Frame = +2 Query: 38 RCACHILNLCVQDGYTYVEDVTKIVRHCFVH*LFQS*TTM--FKSLCVEQNISYRVFKTD 211 RC CH++NLCVQDG E + K R +H L S FK LC+E N+ +R FK D Sbjct: 1 RCVCHVMNLCVQDGLNCAEAIIKPFREIVLH-LRHSGIKRDDFKRLCLEHNLPFRRFKLD 59 Query: 212 AIIGRNTTLDML 247 N+T DML Sbjct: 60 CKTRWNSTYDML 71