BLASTX nr result
ID: Catharanthus23_contig00039797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00039797 (334 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250575.1| PREDICTED: uncharacterized protein LOC101258... 65 1e-10 >ref|XP_004250575.1| PREDICTED: uncharacterized protein LOC101258430 [Solanum lycopersicum] Length = 587 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 33/57 (57%), Positives = 39/57 (68%) Frame = -2 Query: 255 ILYENYTYGNFIGTCV*EGIALCNEIKLNQ*IKRQRLTERRQLGQFYSQFRIEIPSE 85 I Y TYG IGTC EG+ LCNE+KL Q IKR + +ER QLG F +QF IE PS+ Sbjct: 38 IPYNTLTYGKLIGTCTQEGLNLCNELKLAQQIKRTQKSERSQLGDFCTQFGIEGPSK 94 Score = 26.2 bits (56), Expect(2) = 1e-10 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -1 Query: 307 KFIDRLPNLFIQRVKK 260 KF+D LP LF +RVKK Sbjct: 14 KFVDGLPPLFSERVKK 29