BLASTX nr result
ID: Catharanthus23_contig00037874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00037874 (231 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006343734.1| PREDICTED: uncharacterized protein LOC102590... 56 2e-06 >ref|XP_006343734.1| PREDICTED: uncharacterized protein LOC102590164 [Solanum tuberosum] Length = 1105 Score = 55.8 bits (133), Expect(2) = 2e-06 Identities = 24/59 (40%), Positives = 37/59 (62%) Frame = -2 Query: 221 NIHHPFYVYPSESPNQSLADTLLDGGNYHSWNREVRISLGSINKIYFILDSTRITKPNS 45 N HP+Y+ PS+SP +L + + DG NY +W R V ISL + NK+ F+ D + + +S Sbjct: 22 NSSHPYYLTPSDSPGNNLINIIFDGSNYGNWKRGVLISLSAKNKLCFVDDKAIVPQEDS 80 Score = 21.2 bits (43), Expect(2) = 2e-06 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -1 Query: 36 LYGYWKQANDMV 1 L+ +W++ NDMV Sbjct: 82 LFDHWRRCNDMV 93