BLASTX nr result
ID: Catharanthus23_contig00037772
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00037772 (294 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY30928.1| Homeodomain-like superfamily protein [Theobroma c... 49 3e-07 ref|XP_002529346.1| conserved hypothetical protein [Ricinus comm... 50 8e-07 gb|EXB76260.1| Two-component response regulator [Morus notabilis] 49 2e-06 >gb|EOY30928.1| Homeodomain-like superfamily protein [Theobroma cacao] Length = 467 Score = 48.9 bits (115), Expect(2) = 3e-07 Identities = 32/51 (62%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = -2 Query: 170 DWSGSIGNWKLESSSWKADA--NGGENERQIKGLVA-REAGEESHGSEITL 27 D S SI + K ESSSWK ++ NGG ER KGL A RE GEES+GSEITL Sbjct: 417 DRSESIEDGKSESSSWKGESGDNGGAGER--KGLAALREEGEESNGSEITL 465 Score = 31.2 bits (69), Expect(2) = 3e-07 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = -1 Query: 276 PPPVAHHHQFYNQIHVYQS 220 PPP HHH ++Q+H+Y++ Sbjct: 382 PPPQLHHHAIHHQLHMYKA 400 >ref|XP_002529346.1| conserved hypothetical protein [Ricinus communis] gi|223531166|gb|EEF33013.1| conserved hypothetical protein [Ricinus communis] Length = 474 Score = 49.7 bits (117), Expect(2) = 8e-07 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%) Frame = -2 Query: 251 SSTTKSMYINPFADAKLVGI*CQRRFRDWSGSIGNWKLESSSWKADANGGENERQIKGLV 72 + T + +P +D + G D S SI + K ESSSWKA++ GEN + KGL Sbjct: 407 NKATSQAHSSPESDIRGTG--------DRSESIEDGKSESSSWKAES--GENGGERKGLA 456 Query: 71 A-REAGEESHGSEITL 27 A RE GEES+GSEITL Sbjct: 457 AFREDGEESNGSEITL 472 Score = 28.9 bits (63), Expect(2) = 8e-07 Identities = 10/21 (47%), Positives = 15/21 (71%), Gaps = 2/21 (9%) Frame = -1 Query: 282 PIPPP--VAHHHQFYNQIHVY 226 P+PPP HHH ++Q+H+Y Sbjct: 386 PLPPPHHQLHHHTLHHQLHMY 406 >gb|EXB76260.1| Two-component response regulator [Morus notabilis] Length = 495 Score = 48.9 bits (115), Expect(2) = 2e-06 Identities = 34/73 (46%), Positives = 44/73 (60%), Gaps = 1/73 (1%) Frame = -2 Query: 242 TKSMYINPFADAKLVGI*CQRRFRDWSGSIGNWKLESSSWKADANGGENERQIKGLVA-R 66 T ++ +P +D + G D S SI + K ESSSWK ++ GEN + KGL A R Sbjct: 431 TSQIHSSPESDVRGAG--------DRSESIEDGKSESSSWKGES--GENGGERKGLAALR 480 Query: 65 EAGEESHGSEITL 27 E GEES+GSEITL Sbjct: 481 EDGEESNGSEITL 493 Score = 28.5 bits (62), Expect(2) = 2e-06 Identities = 10/24 (41%), Positives = 17/24 (70%), Gaps = 5/24 (20%) Frame = -1 Query: 276 PPPVAHHHQ-----FYNQIHVYQS 220 PPP+ HHHQ ++Q+H+Y++ Sbjct: 407 PPPMPHHHQLHHHALHHQLHMYKA 430