BLASTX nr result
ID: Catharanthus23_contig00037760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00037760 (313 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67974.1| hypothetical protein VITISV_024924 [Vitis vinifera] 58 1e-06 >emb|CAN67974.1| hypothetical protein VITISV_024924 [Vitis vinifera] Length = 796 Score = 58.2 bits (139), Expect = 1e-06 Identities = 30/75 (40%), Positives = 43/75 (57%) Frame = -3 Query: 293 YLSGRTEKISPPFRSEAYGELSIEKFGKPAYRNAVHSKNEYHNFNGLLRGLFRHIRHSKK 114 Y SG P + EAY E ++EKF + A NA H + H+ + ++ GL RHIR+SKK Sbjct: 676 YRSGYQMMFHPTSKQEAYEE-AVEKFRRSAVINAPHKQQGRHHLHAMVEGLLRHIRNSKK 734 Query: 113 SKIPAKNVKILGKGQ 69 SK + ++G GQ Sbjct: 735 SKAGRGGISLVGNGQ 749