BLASTX nr result
ID: Catharanthus23_contig00036767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00036767 (277 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237759.1| PREDICTED: pentatricopeptide repeat-containi... 63 5e-08 gb|EOY16597.1| Pentatricopeptide repeat superfamily protein [The... 60 4e-07 ref|XP_003602124.1| Pentatricopeptide repeat-containing protein ... 57 3e-06 >ref|XP_004237759.1| PREDICTED: pentatricopeptide repeat-containing protein At3g21470-like [Solanum lycopersicum] Length = 528 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +1 Query: 31 HYVLLSSIYAVSEKWQKAEGMRVALTAQGSQKTPGYSAVILESTET 168 HYV+ S+IYA +E+W+KAE MR AL+ +GSQKTPG S V+L+ ET Sbjct: 475 HYVIFSNIYAAAERWEKAERMRYALSNKGSQKTPGCSVVMLDGPET 520 >gb|EOY16597.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 578 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = +1 Query: 31 HYVLLSSIYAVSEKWQKAEGMRVALTAQGSQKTPGYSAVIL 153 HYVLLS+IYA S++W+KAE MR+ + ++G QKTPG S+VIL Sbjct: 501 HYVLLSNIYAASDRWEKAEKMRMTMVSKGFQKTPGLSSVIL 541 >ref|XP_003602124.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355491172|gb|AES72375.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 616 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/53 (49%), Positives = 38/53 (71%) Frame = +1 Query: 31 HYVLLSSIYAVSEKWQKAEGMRVALTAQGSQKTPGYSAVILESTETGVILPSE 189 H VLLS+IYA SEKW+KAE +R ++ GS+K PGYS++IL ++ + + E Sbjct: 483 HNVLLSNIYAASEKWEKAEMIRSSMVDGGSEKIPGYSSIILSNSAVDLSISKE 535