BLASTX nr result
ID: Catharanthus23_contig00036332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00036332 (256 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ20959.1| hypothetical protein PRUPE_ppa024589mg, partial [... 55 7e-06 >gb|EMJ20959.1| hypothetical protein PRUPE_ppa024589mg, partial [Prunus persica] Length = 101 Score = 55.5 bits (132), Expect = 7e-06 Identities = 22/49 (44%), Positives = 32/49 (65%) Frame = +2 Query: 86 MDKGWMYSRDRTSNEYLAKFDEFLDFEYQYNDENSMVYCPCKTCGNCFF 232 MDK W+ DR+SN+YL + FLDF + + ++ +YCPCK C N +F Sbjct: 1 MDKSWIDLTDRSSNQYLNGLESFLDFSFDNSVGDTRIYCPCKKCYNRYF 49