BLASTX nr result
ID: Catharanthus23_contig00034247
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00034247 (321 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529250.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002529250.1| conserved hypothetical protein [Ricinus communis] gi|223531286|gb|EEF33128.1| conserved hypothetical protein [Ricinus communis] Length = 141 Score = 55.1 bits (131), Expect = 1e-05 Identities = 33/97 (34%), Positives = 39/97 (40%), Gaps = 2/97 (2%) Frame = -1 Query: 288 MDWVYPRRRGPEWKLGWTGQTMXXXXXXXXXXXXXXXXXXXXXPMSLSTNYKEQLDRATX 109 M+W YPRRRGPEWK GWTGQT+ +S T+YK QL + Sbjct: 1 MEWFYPRRRGPEWKQGWTGQTLGSISIPPPPLLVIFGIVILLLWLSQYTDYKAQLHHSAI 60 Query: 108 XXXXXXXXXXXXXXXXVRSSFTNW--NFNLWVPRPRR 4 + S TNW F L PR R Sbjct: 61 NFQLFLFLLPVLLILLIASYSTNWMPYFRLRQPRSGR 97