BLASTX nr result
ID: Catharanthus23_contig00034238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00034238 (280 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY01341.1| RNA-binding family protein isoform 1 [Theobroma c... 58 1e-06 >gb|EOY01341.1| RNA-binding family protein isoform 1 [Theobroma cacao] Length = 311 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -2 Query: 153 MSVPMDHSDPKPEEKSKANSNQNWTINVPDQVRTVKVSNVSLAASNKDIQE 1 MSVP+DH++ + N NWTINV D +RTVKVSN+SLAAS +DI+E Sbjct: 1 MSVPLDHTNQSLGAVPRTNGIANWTINVSD-IRTVKVSNISLAASQRDIKE 50