BLASTX nr result
ID: Catharanthus23_contig00033211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00033211 (499 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P37829.1|SCRK_SOLTU RecName: Full=Fructokinase gi|297015|emb|... 62 1e-07 ref|XP_006372862.1| hypothetical protein POPTR_0017s05770g [Popu... 62 1e-07 gb|AFW90635.1| fructokinase-like protein [Solanum tuberosum] 62 1e-07 ref|NP_001233888.1| fructokinase-2 [Solanum lycopersicum] gi|752... 62 1e-07 ref|XP_002337358.1| predicted protein [Populus trichocarpa] 62 1e-07 sp|Q7XJ81.1|SCRK2_SOLHA RecName: Full=Fructokinase-2 gi|32765547... 62 1e-07 gb|AFW90586.1| fructokinase [Solanum tuberosum] 60 3e-07 gb|ABB29956.1| fructokinase-like [Solanum tuberosum] 60 3e-07 ref|XP_006347302.1| PREDICTED: fructokinase-2 [Solanum tuberosum... 60 3e-07 gb|AFO84081.1| fructokinase [Actinidia chinensis] 59 5e-07 gb|EPS66213.1| hypothetical protein M569_08566, partial [Genlise... 59 5e-07 gb|AFR11330.1| fructokinase, partial [Actinidia eriantha] 59 5e-07 gb|AAQ09999.1| putative fructokinase 2 [Petunia integrifolia sub... 59 5e-07 gb|AAQ10000.1| putative fructokinase 2 [Petunia integrifolia sub... 59 5e-07 gb|EPS68794.1| fructokinase-like protein, partial [Genlisea aurea] 58 1e-06 ref|XP_006294594.1| hypothetical protein CARUB_v10023630mg [Caps... 58 1e-06 gb|ABC01889.1| fructokinase-like protein [Solanum tuberosum] 58 2e-06 ref|XP_006417964.1| hypothetical protein EUTSA_v10008196mg [Eutr... 57 3e-06 ref|XP_002881172.1| pfkB-type carbohydrate kinase family protein... 57 3e-06 ref|NP_172092.1| putative fructokinase-3 [Arabidopsis thaliana] ... 57 3e-06 >sp|P37829.1|SCRK_SOLTU RecName: Full=Fructokinase gi|297015|emb|CAA78283.1| fructokinase [Solanum tuberosum] gi|1095321|prf||2108342A fructokinase Length = 319 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 211 SAMSLWHPNLKLLLVTLGEKGCNYYTK 237 >ref|XP_006372862.1| hypothetical protein POPTR_0017s05770g [Populus trichocarpa] gi|550319510|gb|ERP50659.1| hypothetical protein POPTR_0017s05770g [Populus trichocarpa] Length = 267 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTKVTLFSRV 397 +AMSLW PN KLLLVTLGEKGCNYYTKV+ FS V Sbjct: 220 TAMSLWRPNFKLLLVTLGEKGCNYYTKVSNFSSV 253 >gb|AFW90635.1| fructokinase-like protein [Solanum tuberosum] Length = 266 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 221 SAMSLWHPNLKLLLVTLGEKGCNYYTK 247 >ref|NP_001233888.1| fructokinase-2 [Solanum lycopersicum] gi|75221385|sp|Q42896.2|SCRK2_SOLLC RecName: Full=Fructokinase-2 gi|1915974|gb|AAB51108.1| fructokinase [Solanum lycopersicum] gi|2102693|gb|AAB57734.1| fructokinase [Solanum lycopersicum] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 220 SAMSLWHPNLKLLLVTLGEKGCNYYTK 246 >ref|XP_002337358.1| predicted protein [Populus trichocarpa] Length = 146 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTKVTLFSRV 397 +AMSLW PN KLLLVTLGEKGCNYYTKV+ FS V Sbjct: 99 TAMSLWRPNFKLLLVTLGEKGCNYYTKVSNFSSV 132 >sp|Q7XJ81.1|SCRK2_SOLHA RecName: Full=Fructokinase-2 gi|32765547|gb|AAP87283.1| fructokinase 2 [Solanum habrochaites] Length = 328 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 220 SAMSLWHPNLKLLLVTLGEKGCNYYTK 246 >gb|AFW90586.1| fructokinase [Solanum tuberosum] Length = 256 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 495 AMSLWHPNLKLLLVTLGEKGCNYYTK 418 AMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 149 AMSLWHPNLKLLLVTLGEKGCNYYTK 174 >gb|ABB29956.1| fructokinase-like [Solanum tuberosum] Length = 329 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 495 AMSLWHPNLKLLLVTLGEKGCNYYTK 418 AMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 222 AMSLWHPNLKLLLVTLGEKGCNYYTK 247 >ref|XP_006347302.1| PREDICTED: fructokinase-2 [Solanum tuberosum] gi|78191434|gb|ABB29938.1| fructokinase-like [Solanum tuberosum] Length = 329 Score = 60.1 bits (144), Expect = 3e-07 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 495 AMSLWHPNLKLLLVTLGEKGCNYYTK 418 AMSLWHPNLKLLLVTLGEKGCNYYTK Sbjct: 222 AMSLWHPNLKLLLVTLGEKGCNYYTK 247 >gb|AFO84081.1| fructokinase [Actinidia chinensis] Length = 329 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 222 SAMSLWHPNLKLLLVTLGEKGCRYYTK 248 >gb|EPS66213.1| hypothetical protein M569_08566, partial [Genlisea aurea] Length = 323 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 219 SAMSLWHPNLKLLLVTLGEKGCRYYTK 245 >gb|AFR11330.1| fructokinase, partial [Actinidia eriantha] Length = 238 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 206 SAMSLWHPNLKLLLVTLGEKGCRYYTK 232 >gb|AAQ09999.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata] Length = 328 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 220 SAMSLWHPNLKLLLVTLGEKGCRYYTK 246 >gb|AAQ10000.1| putative fructokinase 2 [Petunia integrifolia subsp. inflata] Length = 328 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 220 SAMSLWHPNLKLLLVTLGEKGCRYYTK 246 >gb|EPS68794.1| fructokinase-like protein, partial [Genlisea aurea] Length = 317 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SA+SLWHPNLKLLLVTLGEKGC YYTK Sbjct: 211 SALSLWHPNLKLLLVTLGEKGCRYYTK 237 >ref|XP_006294594.1| hypothetical protein CARUB_v10023630mg [Capsella rubella] gi|482563302|gb|EOA27492.1| hypothetical protein CARUB_v10023630mg [Capsella rubella] Length = 325 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 +AMSLWHPNLKLLLVTLGEKGC YYTK Sbjct: 218 TAMSLWHPNLKLLLVTLGEKGCRYYTK 244 >gb|ABC01889.1| fructokinase-like protein [Solanum tuberosum] Length = 329 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 SAMSLWHPNLKLLLVTLGEKG NYYTK Sbjct: 221 SAMSLWHPNLKLLLVTLGEKGLNYYTK 247 >ref|XP_006417964.1| hypothetical protein EUTSA_v10008196mg [Eutrema salsugineum] gi|557095735|gb|ESQ36317.1| hypothetical protein EUTSA_v10008196mg [Eutrema salsugineum] Length = 325 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 +AMSLWHPNLKLLLVTLGE+GC YYTK Sbjct: 218 AAMSLWHPNLKLLLVTLGERGCRYYTK 244 >ref|XP_002881172.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297327011|gb|EFH57431.1| pfkB-type carbohydrate kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 325 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 +A+SLWHPNLKLLLVTLGEKGC YYTK Sbjct: 218 TALSLWHPNLKLLLVTLGEKGCRYYTK 244 >ref|NP_172092.1| putative fructokinase-3 [Arabidopsis thaliana] gi|75335242|sp|Q9LNE4.1|SCRK3_ARATH RecName: Full=Probable fructokinase-3 gi|8810464|gb|AAF80125.1|AC024174_7 Contains similarity to a fructokinase from Lycopersicon esculentum gi|1915974 and is a member of the pfkB carbohydrate kinase family PF|00294 [Arabidopsis thaliana] gi|67633356|gb|AAY78603.1| pfkB-type carbohydrate kinase family protein [Arabidopsis thaliana] gi|332189809|gb|AEE27930.1| putative fructokinase-3 [Arabidopsis thaliana] Length = 345 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -2 Query: 498 SAMSLWHPNLKLLLVTLGEKGCNYYTK 418 +AMSLWHPNLKLLLVTLGEKGC Y+TK Sbjct: 219 TAMSLWHPNLKLLLVTLGEKGCTYFTK 245