BLASTX nr result
ID: Catharanthus23_contig00033102
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00033102 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75974.1| hypothetical protein VITISV_028848 [Vitis vinifera] 48 2e-07 >emb|CAN75974.1| hypothetical protein VITISV_028848 [Vitis vinifera] Length = 463 Score = 48.1 bits (113), Expect(3) = 2e-07 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 336 RYLGTSKSYVRNRSCPEGCTVEGYVARSACHF 241 RYL T KSYVRN+SCPEG VEGY+A+ F Sbjct: 28 RYLHTLKSYVRNKSCPEGSIVEGYIAKECTTF 59 Score = 28.9 bits (63), Expect(3) = 2e-07 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = -2 Query: 259 KECLSFCFLYLADYGDTKFNRVGRNEDVEENEQDSG 152 KEC +FC YL D +TK +R +N +E N + G Sbjct: 54 KECTTFCPRYLHDV-ETKHDREEKNYVIENNITNGG 88 Score = 22.7 bits (47), Expect(3) = 2e-07 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = -1 Query: 101 ILLRKQLERQHLYLLFKCQTI*PYIE 24 +L ++ + HLY+L C+ + +IE Sbjct: 107 VLSTEEWSQAHLYVLTNCEEVTSFIE 132