BLASTX nr result
ID: Catharanthus23_contig00033096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00033096 (362 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006367063.1| PREDICTED: probable peptide/nitrate transpor... 59 9e-07 ref|XP_003525007.2| PREDICTED: probable peptide/nitrate transpor... 58 1e-06 ref|XP_004241514.1| PREDICTED: probable peptide/nitrate transpor... 57 3e-06 gb|EMJ11477.1| hypothetical protein PRUPE_ppa003007mg [Prunus pe... 57 3e-06 ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transpor... 56 4e-06 ref|XP_006476666.1| PREDICTED: probable peptide/nitrate transpor... 56 4e-06 ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transpor... 56 4e-06 ref|XP_006439664.1| hypothetical protein CICLE_v10019319mg [Citr... 56 4e-06 ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citr... 56 4e-06 ref|XP_006347445.1| PREDICTED: probable peptide/nitrate transpor... 56 6e-06 gb|ESW27341.1| hypothetical protein PHAVU_003G193500g [Phaseolus... 55 7e-06 gb|ADH21397.1| nitrate transporter [Citrus trifoliata] 55 1e-05 >ref|XP_006367063.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Solanum tuberosum] Length = 585 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/41 (60%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGN--EIAMEQI 119 FYYLVA LEVL+FGYFL+CA WY+YK TQ+ E++M+++ Sbjct: 538 FYYLVAALEVLDFGYFLICAKWYKYKGTQNDQKLEVSMDKL 578 >ref|XP_003525007.2| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Glycine max] Length = 597 Score = 57.8 bits (138), Expect = 1e-06 Identities = 20/39 (51%), Positives = 31/39 (79%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAMEQI 119 FYY++A LE++N GYFL+C+ WY+YKET S + + + Q+ Sbjct: 548 FYYMIAALEIMNLGYFLLCSKWYKYKETGSSSNLELNQV 586 >ref|XP_004241514.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Solanum lycopersicum] Length = 578 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/35 (62%), Positives = 28/35 (80%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIA 107 FYYL+AGLE+LN GYFLVCA WY+YK N+++ Sbjct: 534 FYYLIAGLEILNLGYFLVCAKWYKYKGRAGDNKVS 568 >gb|EMJ11477.1| hypothetical protein PRUPE_ppa003007mg [Prunus persica] Length = 612 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAMEQILDEPKKNLD 146 FYYL+A L +N GYFLVCA+WY+YK T++ N + +E L K +D Sbjct: 562 FYYLIAALGAINLGYFLVCANWYKYKGTENNNALGVEVELVREKLLVD 609 >ref|XP_006477526.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Citrus sinensis] Length = 441 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAME 113 +YY++AGLEVLN GYFLV A WY YKET +G+ +E Sbjct: 390 YYYMIAGLEVLNLGYFLVYARWYEYKETGTGSATTIE 426 >ref|XP_006476666.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like isoform X2 [Citrus sinensis] Length = 594 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAME 113 +YY++AGLEVLN GYFLV A WY YKET +G+ +E Sbjct: 543 YYYMIAGLEVLNLGYFLVYARWYEYKETGTGSATTIE 579 >ref|XP_006476665.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like isoform X1 [Citrus sinensis] Length = 621 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAME 113 +YY++AGLEVLN GYFLV A WY YKET +G+ +E Sbjct: 570 YYYMIAGLEVLNLGYFLVYARWYEYKETGTGSATTIE 606 >ref|XP_006439664.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] gi|557541926|gb|ESR52904.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] Length = 457 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAME 113 +YY++AGLEVLN GYFLV A WY YKET +G+ +E Sbjct: 406 YYYMIAGLEVLNLGYFLVYARWYEYKETGTGSATTIE 442 >ref|XP_006439663.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] gi|557541925|gb|ESR52903.1| hypothetical protein CICLE_v10019319mg [Citrus clementina] Length = 621 Score = 56.2 bits (134), Expect = 4e-06 Identities = 23/37 (62%), Positives = 29/37 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAME 113 +YY++AGLEVLN GYFLV A WY YKET +G+ +E Sbjct: 570 YYYMIAGLEVLNLGYFLVYARWYEYKETGTGSATTIE 606 >ref|XP_006347445.1| PREDICTED: probable peptide/nitrate transporter At5g62680-like [Solanum tuberosum] Length = 578 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAMEQILDE 128 FYYL+A LE+LN GYFLVCA WY+YK N+++ DE Sbjct: 534 FYYLIAALEILNLGYFLVCAKWYKYKGRAGDNKVSERTDQDE 575 >gb|ESW27341.1| hypothetical protein PHAVU_003G193500g [Phaseolus vulgaris] Length = 610 Score = 55.5 bits (132), Expect = 7e-06 Identities = 21/46 (45%), Positives = 36/46 (78%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSGNEIAMEQILDEPKKN 140 FY+L+AGLE++N GYF++CA W+RYK T S + + +E++ + +K+ Sbjct: 557 FYFLIAGLEIINLGYFVLCARWFRYKGT-SSSSVELEKVTRQSEKS 601 >gb|ADH21397.1| nitrate transporter [Citrus trifoliata] Length = 588 Score = 55.1 bits (131), Expect = 1e-05 Identities = 25/43 (58%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +3 Query: 3 FYYLVAGLEVLNFGYFLVCAHWYRYKETQSG-NEIAMEQILDE 128 FYYLVA L +LNFG+FL+CA WY+YK + G E+AME++ E Sbjct: 542 FYYLVAALGLLNFGFFLLCAKWYKYKGSGDGAPEVAMEKVNPE 584