BLASTX nr result
ID: Catharanthus23_contig00032692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032692 (227 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289484.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 88 1e-15 gb|EMJ23893.1| hypothetical protein PRUPE_ppa006365mg [Prunus pe... 88 1e-15 ref|XP_006471949.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 86 4e-15 ref|XP_006466567.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 86 4e-15 ref|XP_006433262.1| hypothetical protein CICLE_v10001478mg [Citr... 86 4e-15 ref|XP_006426309.1| hypothetical protein CICLE_v10027093mg, part... 86 4e-15 ref|XP_004139190.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-... 84 2e-14 gb|AAO45753.1| RING/c3HC4/PHD zinc finger-like protein [Cucumis ... 84 2e-14 ref|XP_006382625.1| hypothetical protein POPTR_0005s03900g [Popu... 84 2e-14 gb|EOY15349.1| RING/U-box superfamily protein, putative [Theobro... 84 2e-14 ref|XP_006297819.1| hypothetical protein CARUB_v10013853mg [Caps... 84 2e-14 ref|XP_004301345.1| PREDICTED: RING-H2 finger protein ATL11-like... 84 2e-14 ref|XP_002328426.1| predicted protein [Populus trichocarpa] 84 2e-14 ref|XP_006408102.1| hypothetical protein EUTSA_v10020868mg [Eutr... 84 3e-14 ref|XP_002882402.1| hypothetical protein ARALYDRAFT_477807 [Arab... 84 3e-14 ref|NP_566249.1| E3 ubiquitin-protein ligase ATL6 [Arabidopsis t... 83 3e-14 ref|XP_006394969.1| hypothetical protein EUTSA_v10004360mg [Eutr... 83 3e-14 gb|AAL86301.1| putative RING-H2 zinc finger protein ATL6 [Arabid... 83 3e-14 gb|AAD33584.1|AF132016_1 RING-H2 zinc finger protein ATL6 [Arabi... 83 3e-14 gb|AAF27026.1|AC009177_16 putative RING-H2 zinc finger protein A... 83 3e-14 >ref|XP_004289484.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Fragaria vesca subsp. vesca] Length = 377 Score = 88.2 bits (217), Expect = 1e-15 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLDP +I++FPMF+YSDVK LK+GKGALECAVCL+EFED ETLRLLPK Sbjct: 93 RGLDPAVIEKFPMFVYSDVKDLKIGKGALECAVCLSEFEDYETLRLLPK 141 >gb|EMJ23893.1| hypothetical protein PRUPE_ppa006365mg [Prunus persica] Length = 415 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -2 Query: 154 VTRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 + RGLDP +I+ FP FLYSDVKGL+LGK +LECAVCLNEF+DDETLRL+PK Sbjct: 86 MARGLDPAVIETFPAFLYSDVKGLQLGKDSLECAVCLNEFQDDETLRLIPK 136 >ref|XP_006471949.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Citrus sinensis] Length = 443 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +ID FP F+YSDVK LK+GKGALECAVCLNEFEDDETLRL+PK Sbjct: 164 RGLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPK 212 >ref|XP_006466567.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Citrus sinensis] Length = 291 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLDP +I+ FP+F+YS VK LK+GKGALECAVCL+EFEDDETLRLLPK Sbjct: 124 RGLDPSVIESFPIFVYSAVKDLKIGKGALECAVCLSEFEDDETLRLLPK 172 >ref|XP_006433262.1| hypothetical protein CICLE_v10001478mg [Citrus clementina] gi|557535384|gb|ESR46502.1| hypothetical protein CICLE_v10001478mg [Citrus clementina] Length = 384 Score = 86.3 bits (212), Expect = 4e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +ID FP F+YSDVK LK+GKGALECAVCLNEFEDDETLRL+PK Sbjct: 105 RGLDREVIDTFPTFVYSDVKTLKVGKGALECAVCLNEFEDDETLRLIPK 153 >ref|XP_006426309.1| hypothetical protein CICLE_v10027093mg, partial [Citrus clementina] gi|557528299|gb|ESR39549.1| hypothetical protein CICLE_v10027093mg, partial [Citrus clementina] Length = 548 Score = 86.3 bits (212), Expect = 4e-15 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLDP +I+ FP+F+YS VK LK+GKGALECAVCL+EFEDDETLRLLPK Sbjct: 165 RGLDPSVIESFPIFVYSAVKDLKIGKGALECAVCLSEFEDDETLRLLPK 213 >ref|XP_004139190.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Cucumis sativus] gi|449518671|ref|XP_004166360.1| PREDICTED: E3 ubiquitin-protein ligase ATL6-like [Cucumis sativus] Length = 379 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 TRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 TRGLDP +I+ FP +YSDVK K+GK ALECAVCLNEFEDDETLRL+PK Sbjct: 93 TRGLDPAVIETFPTLIYSDVKEHKIGKSALECAVCLNEFEDDETLRLIPK 142 >gb|AAO45753.1| RING/c3HC4/PHD zinc finger-like protein [Cucumis melo subsp. melo] Length = 379 Score = 84.3 bits (207), Expect = 2e-14 Identities = 38/50 (76%), Positives = 43/50 (86%) Frame = -2 Query: 151 TRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 TRGLDP +I+ FP +YSDVK K+GK ALECAVCLNEFEDDETLRL+PK Sbjct: 93 TRGLDPAVIETFPTLIYSDVKEHKIGKSALECAVCLNEFEDDETLRLIPK 142 >ref|XP_006382625.1| hypothetical protein POPTR_0005s03900g [Populus trichocarpa] gi|550337989|gb|ERP60422.1| hypothetical protein POPTR_0005s03900g [Populus trichocarpa] Length = 385 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -2 Query: 151 TRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLP 5 +RGLDP +I+ FP +YS VKGLK+GKGALECAVCLNEFE+DETLRL+P Sbjct: 98 SRGLDPAVIETFPTLIYSVVKGLKIGKGALECAVCLNEFEEDETLRLIP 146 >gb|EOY15349.1| RING/U-box superfamily protein, putative [Theobroma cacao] Length = 420 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 154 VTRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 +TRGLD +I+ FP FLYS VKGLK+G LECAVCLNEFEDDETLRL+PK Sbjct: 114 LTRGLDASVIESFPTFLYSTVKGLKIGNDTLECAVCLNEFEDDETLRLIPK 164 >ref|XP_006297819.1| hypothetical protein CARUB_v10013853mg [Capsella rubella] gi|482566528|gb|EOA30717.1| hypothetical protein CARUB_v10013853mg [Capsella rubella] Length = 405 Score = 84.0 bits (206), Expect = 2e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 104 RGLDAAVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 152 >ref|XP_004301345.1| PREDICTED: RING-H2 finger protein ATL11-like [Fragaria vesca subsp. vesca] Length = 364 Score = 84.0 bits (206), Expect = 2e-14 Identities = 36/51 (70%), Positives = 45/51 (88%) Frame = -2 Query: 154 VTRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 + RGLDP +I+ FP FL+SDVKGL LGK +L+CAVCLN+F+DDETLRL+PK Sbjct: 42 MNRGLDPAVIESFPAFLFSDVKGLHLGKDSLQCAVCLNDFQDDETLRLIPK 92 >ref|XP_002328426.1| predicted protein [Populus trichocarpa] Length = 374 Score = 84.0 bits (206), Expect = 2e-14 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = -2 Query: 151 TRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLP 5 +RGLDP +I+ FP +YS VKGLK+GKGALECAVCLNEFE+DETLRL+P Sbjct: 87 SRGLDPAVIETFPTLIYSVVKGLKIGKGALECAVCLNEFEEDETLRLIP 135 >ref|XP_006408102.1| hypothetical protein EUTSA_v10020868mg [Eutrema salsugineum] gi|557109248|gb|ESQ49555.1| hypothetical protein EUTSA_v10020868mg [Eutrema salsugineum] Length = 397 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 102 RGLDASVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 150 >ref|XP_002882402.1| hypothetical protein ARALYDRAFT_477807 [Arabidopsis lyrata subsp. lyrata] gi|297328242|gb|EFH58661.1| hypothetical protein ARALYDRAFT_477807 [Arabidopsis lyrata subsp. lyrata] Length = 398 Score = 83.6 bits (205), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 98 RGLDASVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 146 >ref|NP_566249.1| E3 ubiquitin-protein ligase ATL6 [Arabidopsis thaliana] gi|68565231|sp|Q8RXX9.2|ATL6_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL6; AltName: Full=RING-H2 finger protein ATL6; Flags: Precursor gi|70905101|gb|AAZ14076.1| At3g05200 [Arabidopsis thaliana] gi|332640683|gb|AEE74204.1| E3 ubiquitin-protein ligase ATL6 [Arabidopsis thaliana] Length = 398 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 98 RGLDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 146 >ref|XP_006394969.1| hypothetical protein EUTSA_v10004360mg [Eutrema salsugineum] gi|557091608|gb|ESQ32255.1| hypothetical protein EUTSA_v10004360mg [Eutrema salsugineum] Length = 396 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 154 VTRGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 V RGLD +I+ FP F+YS+VK K+GKGALECA+CLNEFEDDETLRLLPK Sbjct: 113 VARGLDASMIETFPTFVYSEVKTQKIGKGALECAICLNEFEDDETLRLLPK 163 >gb|AAL86301.1| putative RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] Length = 388 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 98 RGLDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 146 >gb|AAD33584.1|AF132016_1 RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] Length = 398 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 98 RGLDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 146 >gb|AAF27026.1|AC009177_16 putative RING-H2 zinc finger protein ATL6 [Arabidopsis thaliana] Length = 392 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -2 Query: 148 RGLDPIIIDEFPMFLYSDVKGLKLGKGALECAVCLNEFEDDETLRLLPK 2 RGLD +++ FP FLYSDVK KLGKG LECA+CLNEFEDDETLRLLPK Sbjct: 92 RGLDVSVVETFPTFLYSDVKTQKLGKGELECAICLNEFEDDETLRLLPK 140