BLASTX nr result
ID: Catharanthus23_contig00032638
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032638 (518 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616704.1| hypothetical protein MTR_5g083380 [Medicago ... 44 2e-06 >ref|XP_003616704.1| hypothetical protein MTR_5g083380 [Medicago truncatula] gi|355518039|gb|AES99662.1| hypothetical protein MTR_5g083380 [Medicago truncatula] Length = 323 Score = 44.3 bits (103), Expect(2) = 2e-06 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 3/77 (3%) Frame = -3 Query: 270 FQPYNFSGKRLSNRRKQYFCVF*NNNGHTIDRCYKKHDFPPN---QKFKGKLGGSFGDHG 100 FQP S+ + C + N +GHTI+ CYKKH FPP+ Q + S G Sbjct: 233 FQPRGKGSYYGSSGKPSRLCTYCNRSGHTIETCYKKHGFPPHFGRQNVSANVSSSDGIET 292 Query: 99 RGHTQTN*KYCLRREYS 49 + TN R +++ Sbjct: 293 HLQSSTNEDTSTRNQFN 309 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 14/31 (45%), Positives = 23/31 (74%) Frame = -1 Query: 482 GLNDSFKSVRSKVLMTVPLLDMNTVFNMAIK 390 GLND+F V+S+VL+ PL +N V++M ++ Sbjct: 170 GLNDNFSVVKSQVLLMEPLPSINKVYSMFVQ 200