BLASTX nr result
ID: Catharanthus23_contig00032563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032563 (298 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244367.1| PREDICTED: dynein light chain, cytoplasmic-l... 57 2e-06 ref|XP_006370272.1| hypothetical protein POPTR_0001s41180g [Popu... 57 3e-06 ref|XP_006348247.1| PREDICTED: dynein light chain, cytoplasmic-l... 56 4e-06 ref|XP_002329139.1| predicted protein [Populus trichocarpa] 55 1e-05 >ref|XP_004244367.1| PREDICTED: dynein light chain, cytoplasmic-like [Solanum lycopersicum] Length = 147 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 5/71 (7%) Frame = +3 Query: 93 PAHLSRQTSLPAAPKVNNDHPNSLSR-----EELKLAAVSISLNVRLRSAEMPISMLERA 257 P H S +SL K NN++ N +S+ EE+KLAA++IS N+RLRSA+MP +M A Sbjct: 2 PMH-SSSSSLSRRQKPNNNNENGISKSMSAEEEVKLAALAISFNIRLRSADMPFAMQAHA 60 Query: 258 FRFARSIVDTP 290 R+AR+++ P Sbjct: 61 LRYARTLLLQP 71 >ref|XP_006370272.1| hypothetical protein POPTR_0001s41180g [Populus trichocarpa] gi|550349451|gb|ERP66841.1| hypothetical protein POPTR_0001s41180g [Populus trichocarpa] Length = 129 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/45 (57%), Positives = 37/45 (82%) Frame = +3 Query: 159 SLSREELKLAAVSISLNVRLRSAEMPISMLERAFRFARSIVDTPT 293 S + E +KLAA+++SLNVRLRS++MP+ M ERA R+ARS +D P+ Sbjct: 6 SPTEEVMKLAAIALSLNVRLRSSDMPVDMQERALRYARSFLDDPS 50 >ref|XP_006348247.1| PREDICTED: dynein light chain, cytoplasmic-like [Solanum tuberosum] Length = 147 Score = 56.2 bits (134), Expect = 4e-06 Identities = 32/71 (45%), Positives = 48/71 (67%), Gaps = 5/71 (7%) Frame = +3 Query: 93 PAHLSRQTSLPAAPKVNNDHPNSLSR-----EELKLAAVSISLNVRLRSAEMPISMLERA 257 P H S +SL K NN++ N +S+ EE+KLAA++I+LN+RLRSA+MP +M A Sbjct: 2 PMH-SSSSSLSRRQKPNNNNENVISKSMSAEEEVKLAALAITLNIRLRSADMPFAMQAYA 60 Query: 258 FRFARSIVDTP 290 R+AR+++ P Sbjct: 61 LRYARTLLLQP 71 >ref|XP_002329139.1| predicted protein [Populus trichocarpa] Length = 118 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = +3 Query: 177 LKLAAVSISLNVRLRSAEMPISMLERAFRFARSIVDTPT 293 +KLAA+++SLNVRLRS++MP+ M ERA R+ARS +D P+ Sbjct: 1 MKLAAIALSLNVRLRSSDMPVDMQERALRYARSFLDDPS 39