BLASTX nr result
ID: Catharanthus23_contig00032364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032364 (345 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus... 138 7e-31 sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized p... 137 2e-30 gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] 97 3e-26 prf||1211235CB ORF 87 96 1e-25 ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana ... 96 1e-25 ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorr... 97 1e-25 ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis... 97 1e-25 ref|YP_007353959.1| Ycf15 protein (chloroplast) [Tectona grandis... 97 1e-25 ref|YP_006503835.1| hypothetical chloroplast RF15 (chloroplast) ... 96 1e-25 gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulg... 97 2e-25 ref|YP_007317293.1| Ycf15 (chloroplast) [Camellia sinensis] gi|4... 97 3e-25 sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized p... 94 4e-25 ref|YP_008563133.1| hypothetical chloroplast RF15 (chloroplast) ... 96 5e-25 ref|YP_004940553.1| ycf15 gene product (chloroplast) [Boea hygro... 97 5e-25 gb|AGL45397.1| Ycf15 (chloroplast) [Sesamum indicum] 97 6e-25 ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum in... 97 6e-25 gb|ADD72133.1| hypothetical chloroplast RF15 [Olea europaea] gi|... 92 8e-25 gb|ADZ36326.1| hypothetical protein RF15 [Camellia obtusifolia] 97 1e-24 ref|YP_008592533.1| Ycf15 protein (chloroplast) [Andrographis pa... 96 2e-24 gb|ADZ36362.1| hypothetical protein RF15 [Symplocos paniculata] 97 3e-24 >ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|359422209|ref|YP_004935614.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|558602956|ref|YP_008814988.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558602975|ref|YP_008815005.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558603044|ref|YP_008815075.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603063|ref|YP_008815092.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603132|ref|YP_008815162.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|558603151|ref|YP_008815179.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|563940429|ref|YP_008815249.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|563940448|ref|YP_008815266.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|347448271|gb|AEO92683.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|347448272|gb|AEO92684.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|458599236|gb|AGG39087.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599255|gb|AGG39106.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599415|gb|AGG39174.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599434|gb|AGG39193.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599568|gb|AGG39261.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599587|gb|AGG39280.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599656|gb|AGG39348.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|458599675|gb|AGG39367.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] Length = 100 Score = 138 bits (348), Expect = 7e-31 Identities = 69/84 (82%), Positives = 72/84 (85%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG*ALKGEGRLEC 248 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPV IFTTKK F G + EGRLEC Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVHIFTTKKRSTGFRIG--PESEGRLEC 76 Query: 249 QQASIIEFTRPDSTHFGNVQCQSH 320 QQASIIEFTRPDSTHFGNVQCQSH Sbjct: 77 QQASIIEFTRPDSTHFGNVQCQSH 100 >sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized protein ycf15 gi|51235357|gb|AAT98553.1| ycf15 protein [Panax ginseng] gi|51235376|gb|AAT98572.1| ycf15 protein [Panax ginseng] gi|506444470|gb|AGM15032.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444471|gb|AGM15033.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444558|gb|AGM15118.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444559|gb|AGM15119.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444674|gb|AGM15204.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444675|gb|AGM15205.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] Length = 100 Score = 137 bits (344), Expect = 2e-30 Identities = 68/84 (80%), Positives = 72/84 (85%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG*ALKGEGRLEC 248 LLLK GRIEI++QNTMYGWYELPKQEF+NSEQPV IFTTKK F G + EGRLEC Sbjct: 19 LLLKHGRIEILEQNTMYGWYELPKQEFLNSEQPVHIFTTKKRSTGFRIG--PESEGRLEC 76 Query: 249 QQASIIEFTRPDSTHFGNVQCQSH 320 QQASIIEFTRPDSTHFGNVQCQSH Sbjct: 77 QQASIIEFTRPDSTHFGNVQCQSH 100 >gb|ADZ36339.1| hypothetical protein RF15 [Franklinia alatamaha] Length = 82 Score = 97.1 bits (240), Expect(2) = 3e-26 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 47.0 bits (110), Expect(2) = 3e-26 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 62 ILFRIGPERRRKAGMPTGVYY 82 >prf||1211235CB ORF 87 Length = 87 Score = 95.5 bits (236), Expect(2) = 1e-25 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NS+QPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 47.0 bits (110), Expect(2) = 1e-25 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 62 ILFRIGPERRRKAGMPTGVYY 82 >ref|YP_004891652.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|351653957|ref|YP_004891684.1| ycf15 gene product (chloroplast) [Nicotiana undulata] gi|394831164|ref|YP_006503853.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|404474569|ref|YP_006666074.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|404474586|ref|YP_006666091.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|122201807|sp|Q2MIE3.1|YCF15_SOLBU RecName: Full=Putative uncharacterized protein ycf15 gi|122209875|sp|Q2VED6.1|YCF15_SOLTU RecName: Full=Putative uncharacterized protein ycf15 gi|122213578|sp|Q3C1N3.1|YCF15_NICSY RecName: Full=Putative uncharacterized protein ycf15 gi|4388759|emb|CAA77386.1| Ycf15 protein [Nicotiana tabacum] gi|4388763|emb|CAA77407.1| hypothetical protein [Nicotiana tabacum] gi|77799610|dbj|BAE46699.1| Ycf15 protein [Nicotiana sylvestris] gi|77799643|dbj|BAE46732.1| Ycf15 protein [Nicotiana sylvestris] gi|82754668|gb|ABB90082.1| ycf15 protein [Solanum tuberosum] gi|82754684|gb|ABB90098.1| ycf15 protein [Solanum tuberosum] gi|84371939|gb|ABC56257.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|84371958|gb|ABC56276.1| hypothetical chloroplast RF15 [Solanum bulbocastanum] gi|88656847|gb|ABD47100.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|88656865|gb|ABD47118.1| hypothetical chloroplast RF15 [Solanum tuberosum] gi|329124626|gb|AEB72183.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124643|gb|AEB72200.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124713|gb|AEB72269.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|329124730|gb|AEB72286.1| hypothetical chloroplast RF15 (chloroplast) [Solanum tuberosum] gi|347453955|gb|AEO95613.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347453983|gb|AEO95641.1| hypothetical chloroplast RF15 (chloroplast) [Nicotiana undulata] gi|347454066|gb|AEO95723.1| hypothetical chloroplast RF15 [synthetic construct] gi|347454092|gb|AEO95749.1| hypothetical chloroplast RF15 [synthetic construct] gi|350996487|gb|AEQ36999.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|350996575|gb|AEQ37086.1| hypothetical chloroplast RF15 [Datura stramonium] gi|401065976|gb|AFP90820.1| Ycf15 protein (chloroplast) [Capsicum annuum] gi|401065993|gb|AFP90837.1| Ycf15 protein (chloroplast) [Capsicum annuum] Length = 87 Score = 95.5 bits (236), Expect(2) = 1e-25 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NS+QPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 47.0 bits (110), Expect(2) = 1e-25 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 62 ILFRIGPERRRKAGMPTGVYY 82 >ref|YP_007507156.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|459014555|ref|YP_007507173.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879786|gb|AFQ30973.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|401879805|gb|AFQ30992.1| ycf15 protein (chloroplast) [Salvia miltiorrhiza] gi|573461996|emb|CCQ71665.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] gi|573462015|emb|CCQ71684.1| Ycf15 (chloroplast) [Salvia miltiorrhiza] Length = 82 Score = 97.1 bits (240), Expect(2) = 1e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 45.4 bits (106), Expect(2) = 1e-25 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRK GMPTGVYY Sbjct: 62 ILFRIGPERRRKGGMPTGVYY 82 >ref|YP_007353976.1| Ycf15 protein (chloroplast) [Tectona grandis] gi|438687665|emb|CCP47195.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688349|emb|CCP47284.1| ycf15 protein (chloroplast) [Tectona grandis] gi|438688473|emb|CCP47373.1| ycf15 protein (chloroplast) [Tectona grandis] Length = 82 Score = 97.1 bits (240), Expect(2) = 1e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 45.4 bits (106), Expect(2) = 1e-25 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRK GMPTGVYY Sbjct: 62 ILFRIGPERRRKGGMPTGVYY 82 >ref|YP_007353959.1| Ycf15 protein (chloroplast) [Tectona grandis] gi|438687648|emb|CCP47175.1| hypothetical protein BN828_cpI0890 (chloroplast) [Tectona grandis] gi|438688332|emb|CCP47264.1| hypothetical protein BN828_cpII0890 (chloroplast) [Tectona grandis] gi|438688456|emb|CCP47353.1| hypothetical protein BN828_cpIII0890 (chloroplast) [Tectona grandis] Length = 65 Score = 97.1 bits (240), Expect(2) = 1e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 2 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 50 Score = 45.4 bits (106), Expect(2) = 1e-25 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRK GMPTGVYY Sbjct: 45 ILFRIGPERRRKGGMPTGVYY 65 >ref|YP_006503835.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|140322|sp|P12195.1|YCF15_TOBAC RecName: Full=Putative uncharacterized protein ycf15; AltName: Full=ORF 70; AltName: Full=ORF 87 gi|75139596|sp|Q7FNR5.1|YCF15_ATRBE RecName: Full=Putative uncharacterized protein ycf15 gi|20068375|emb|CAC88088.1| ycf15 protein [Atropa belladonna] gi|20068394|emb|CAC88107.1| ycf15 protein [Atropa belladonna] gi|350996470|gb|AEQ36982.1| hypothetical chloroplast RF15 (chloroplast) [Datura stramonium] gi|350996556|gb|AEQ37067.1| hypothetical chloroplast RF15 [Datura stramonium] Length = 70 Score = 95.5 bits (236), Expect(2) = 1e-25 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NS+QPVQIFTTKKYWILF G Sbjct: 2 LLLKHGRIEILDQNTMYGWYELPKQEFLNSKQPVQIFTTKKYWILFRIG 50 Score = 47.0 bits (110), Expect(2) = 1e-25 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 45 ILFRIGPERRRKAGMPTGVYY 65 >gb|AFV61857.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176215|gb|AFV61874.1| Ycf15 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 82 Score = 96.7 bits (239), Expect(2) = 2e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRVG 67 Score = 45.1 bits (105), Expect(2) = 2e-25 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFR+GPERRRK GMPTGVYY Sbjct: 62 ILFRVGPERRRKGGMPTGVYY 82 >ref|YP_007317293.1| Ycf15 (chloroplast) [Camellia sinensis] gi|435856435|ref|YP_007317310.1| Ycf15 (chloroplast) [Camellia sinensis] gi|542688173|ref|YP_008520184.1| Ycf15 (chloroplast) [Camellia taliensis] gi|542688174|ref|YP_008520203.1| Ycf15 (chloroplast) [Camellia taliensis] gi|552539647|ref|YP_008592802.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|552539648|ref|YP_008592821.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|552540895|ref|YP_008592888.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|552540896|ref|YP_008592908.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|552540989|ref|YP_008592978.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|552540990|ref|YP_008592997.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|552541083|ref|YP_008593156.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|552541084|ref|YP_008593175.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|552546242|ref|YP_008593067.1| Ycf15 (chloroplast) [Camellia pitardii] gi|552546243|ref|YP_008593086.1| Ycf15 (chloroplast) [Camellia pitardii] gi|568244603|ref|YP_008963350.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|568244622|ref|YP_008963369.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893251|gb|AFK81343.1| hypothetical chloroplast RF15 [Camellia sinensis var. assamica] gi|388893270|gb|AFK81362.1| hypothetical chloroplast RF15 [Camellia sinensis var. assamica] gi|388893339|gb|AFK81430.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893358|gb|AFK81449.1| hypothetical chloroplast RF15 [Camellia oleifera] gi|388893427|gb|AFK81517.1| hypothetical chloroplast RF15 [Camellia taliensis] gi|388893446|gb|AFK81536.1| hypothetical chloroplast RF15 [Camellia taliensis] gi|430728317|gb|AGA55641.1| Ycf15 (chloroplast) [Camellia sinensis] gi|430728334|gb|AGA55658.1| Ycf15 (chloroplast) [Camellia sinensis] gi|537362465|gb|AGU44273.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|537362466|gb|AGU44274.1| Ycf15 (chloroplast) [Camellia cuspidata] gi|537362554|gb|AGU44361.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|537362555|gb|AGU44362.1| Ycf15 (chloroplast) [Camellia danzaiensis] gi|537362643|gb|AGU44449.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|537362644|gb|AGU44450.1| Ycf15 (chloroplast) [Camellia impressinervis] gi|537362733|gb|AGU44538.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537362734|gb|AGU44539.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537362823|gb|AGU44627.1| Ycf15 (chloroplast) [Camellia pitardii] gi|537362824|gb|AGU44628.1| Ycf15 (chloroplast) [Camellia pitardii] gi|537362913|gb|AGU44716.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|537362914|gb|AGU44717.1| Ycf15 (chloroplast) [Camellia yunnanensis] gi|537363003|gb|AGU44805.1| Ycf15 (chloroplast) [Camellia taliensis] gi|537363004|gb|AGU44806.1| Ycf15 (chloroplast) [Camellia taliensis] gi|555945960|gb|AGZ19187.1| hypothetical chloroplast RF15 (chloroplast) [Camellia sinensis] Length = 82 Score = 97.1 bits (240), Expect(2) = 3e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 43.9 bits (102), Expect(2) = 3e-25 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIG ERRRKAGMPTGVYY Sbjct: 62 ILFRIGSERRRKAGMPTGVYY 82 >sp|Q33BV4.1|YCF15_NICTO RecName: Full=Putative uncharacterized protein ycf15 gi|80750972|dbj|BAE48048.1| Ycf15 protein [Nicotiana tomentosiformis] gi|80751005|dbj|BAE48081.1| Ycf15 protein [Nicotiana tomentosiformis] Length = 87 Score = 93.6 bits (231), Expect(2) = 4e-25 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF++S+QPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLSSKQPVQIFTTKKYWILFRIG 67 Score = 47.0 bits (110), Expect(2) = 4e-25 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 62 ILFRIGPERRRKAGMPTGVYY 82 >ref|YP_008563133.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|544163676|ref|YP_008563150.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|544170716|ref|AP_004972.1| Ycf15 protein (chloroplast) [Solanum lycopersicum] gi|544170734|ref|AP_004990.1| ycf15 protein (chloroplast) [Solanum lycopersicum] gi|122201759|sp|Q2MI39.1|YCF15_SOLLC RecName: Full=Putative uncharacterized protein ycf15 gi|84372027|gb|ABC56344.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|84372046|gb|ABC56363.1| hypothetical chloroplast RF15 (chloroplast) [Solanum lycopersicum] gi|89241715|emb|CAJ32438.1| Ycf15 protein [Solanum lycopersicum] gi|89241733|emb|CAJ32456.1| ycf15 protein [Solanum lycopersicum] Length = 87 Score = 95.5 bits (236), Expect(2) = 5e-25 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NS+QPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSKQPVQIFTTKKYWILFRIG 67 Score = 44.7 bits (104), Expect(2) = 5e-25 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMP GVYY Sbjct: 62 ILFRIGPERRRKAGMPIGVYY 82 >ref|YP_004940553.1| ycf15 gene product (chloroplast) [Boea hygrometrica] gi|364284046|ref|YP_004940571.1| ycf15 gene product (chloroplast) [Boea hygrometrica] gi|340549451|gb|AEK53273.1| hypothetical chloroplast RF15 (chloroplast) [Boea hygrometrica] gi|340549469|gb|AEK53291.1| hypothetical chloroplast RF15 (chloroplast) [Boea hygrometrica] Length = 82 Score = 97.1 bits (240), Expect(2) = 5e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 43.1 bits (100), Expect(2) = 5e-25 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGP+RRRK GMPTGVYY Sbjct: 62 ILFRIGPKRRRKDGMPTGVYY 82 >gb|AGL45397.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 65 Score = 97.1 bits (240), Expect(2) = 6e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 2 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 50 Score = 42.7 bits (99), Expect(2) = 6e-25 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRK GMPT VYY Sbjct: 45 ILFRIGPERRRKGGMPTDVYY 65 >ref|YP_004935711.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|359422323|ref|YP_004935728.1| ycf15 gene product (chloroplast) [Sesamum indicum] gi|347448340|gb|AEO92751.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|347448357|gb|AEO92768.1| ycf15 protein (chloroplast) [Sesamum indicum] gi|496538645|gb|AGL45380.1| Ycf15 (chloroplast) [Sesamum indicum] Length = 82 Score = 97.1 bits (240), Expect(2) = 6e-25 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 42.7 bits (99), Expect(2) = 6e-25 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRK GMPT VYY Sbjct: 62 ILFRIGPERRRKGGMPTDVYY 82 >gb|ADD72133.1| hypothetical chloroplast RF15 [Olea europaea] gi|291059316|gb|ADD72152.1| hypothetical chloroplast RF15 [Olea europaea] Length = 67 Score = 92.4 bits (228), Expect(2) = 8e-25 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 78 KDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 K GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 7 KHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 52 Score = 47.0 bits (110), Expect(2) = 8e-25 Identities = 20/21 (95%), Positives = 21/21 (100%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKAGMPTGVYY Sbjct: 47 ILFRIGPERRRKAGMPTGVYY 67 >gb|ADZ36326.1| hypothetical protein RF15 [Camellia obtusifolia] Length = 82 Score = 97.1 bits (240), Expect(2) = 1e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 42.0 bits (97), Expect(2) = 1e-24 Identities = 18/21 (85%), Positives = 20/21 (95%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPERRRKA MPTGV+Y Sbjct: 62 ILFRIGPERRRKAEMPTGVHY 82 >ref|YP_008592533.1| Ycf15 protein (chloroplast) [Andrographis paniculata] gi|552541365|ref|YP_008592550.1| Ycf15 protein (chloroplast) [Andrographis paniculata] gi|532164881|gb|AGT79891.1| Ycf15 protein (chloroplast) [Andrographis paniculata] gi|532164898|gb|AGT79908.1| Ycf15 protein (chloroplast) [Andrographis paniculata] Length = 65 Score = 95.5 bits (236), Expect(2) = 2e-24 Identities = 43/49 (87%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPV+IFTTKKYWILF G Sbjct: 2 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVRIFTTKKYWILFRIG 50 Score = 42.4 bits (98), Expect(2) = 2e-24 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIG ERRRK GMPTGVYY Sbjct: 45 ILFRIGSERRRKGGMPTGVYY 65 >gb|ADZ36362.1| hypothetical protein RF15 [Symplocos paniculata] Length = 82 Score = 97.1 bits (240), Expect(2) = 3e-24 Identities = 44/49 (89%), Positives = 46/49 (93%) Frame = +3 Query: 69 LLLKDGRIEIVDQNTMYGWYELPKQEFVNSEQPVQIFTTKKYWILFSFG 215 LLLK GRIEI+DQNTMYGWYELPKQEF+NSEQPVQIFTTKKYWILF G Sbjct: 19 LLLKHGRIEILDQNTMYGWYELPKQEFLNSEQPVQIFTTKKYWILFRIG 67 Score = 40.4 bits (93), Expect(2) = 3e-24 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = +2 Query: 203 LLFRIGPERRRKAGMPTGVYY 265 +LFRIGPER RKA MPTGVYY Sbjct: 62 ILFRIGPERIRKAVMPTGVYY 82