BLASTX nr result
ID: Catharanthus23_contig00032077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032077 (497 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 67 2e-09 ref|YP_001109573.1| hypothetical protein Poptr_cp096 [Populus tr... 44 5e-06 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 67.0 bits (162), Expect = 2e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 142 DPSSWNWNKFGSRSRNLGDLLYLMNGVSALKLSA 41 DPSSWNWNKFGS SRNLGDLLYLMNG SALK SA Sbjct: 19 DPSSWNWNKFGSGSRNLGDLLYLMNGESALKSSA 52 >ref|YP_001109573.1| hypothetical protein Poptr_cp096 [Populus trichocarpa] gi|133712134|gb|ABO36777.1| conserved hypothetical protein [Populus trichocarpa] Length = 71 Score = 44.3 bits (103), Expect(2) = 5e-06 Identities = 21/28 (75%), Positives = 21/28 (75%) Frame = -2 Query: 151 DSIDPSSWNWNKFGSRSRNLGDLLYLMN 68 DSI NWNKFG SRNLGDLLYLMN Sbjct: 17 DSIRDLLLNWNKFGRGSRNLGDLLYLMN 44 Score = 31.6 bits (70), Expect(2) = 5e-06 Identities = 10/14 (71%), Positives = 14/14 (100%) Frame = -1 Query: 80 LSNEWGVCFKIIRP 39 ++NEWGVCF+I+RP Sbjct: 43 MNNEWGVCFEIVRP 56