BLASTX nr result
ID: Catharanthus23_contig00032068
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032068 (272 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301871.1| hypothetical protein POPTR_0002s26280g [Popu... 57 2e-06 ref|XP_006341929.1| PREDICTED: dentin sialophosphoprotein-like [... 56 4e-06 >ref|XP_002301871.1| hypothetical protein POPTR_0002s26280g [Populus trichocarpa] gi|222843597|gb|EEE81144.1| hypothetical protein POPTR_0002s26280g [Populus trichocarpa] Length = 1077 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 267 FGFLEKDEIVKDVEKQMLNGLLDEITRDLLHI 172 FGFLEKD++V+DVEK MLNGLLDE+TRDLL + Sbjct: 1045 FGFLEKDDVVRDVEKSMLNGLLDEVTRDLLPV 1076 >ref|XP_006341929.1| PREDICTED: dentin sialophosphoprotein-like [Solanum tuberosum] Length = 1069 Score = 56.2 bits (134), Expect = 4e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -3 Query: 267 FGFLEKDEIVKDVEKQMLNGLLDEITRDLLHIPVS 163 FGFLEKD++VKDVEK +LNGL++EIT DLL I +S Sbjct: 1034 FGFLEKDDVVKDVEKHLLNGLINEITMDLLRIAIS 1068