BLASTX nr result
ID: Catharanthus23_contig00032033
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00032033 (407 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270901.2| PREDICTED: B3 domain-containing protein Os07... 57 3e-06 emb|CBI23327.3| unnamed protein product [Vitis vinifera] 57 3e-06 gb|EOY28397.1| Transcription factor, putative isoform 1 [Theobro... 56 6e-06 ref|XP_006842484.1| hypothetical protein AMTR_s00077p00082680 [A... 55 1e-05 >ref|XP_002270901.2| PREDICTED: B3 domain-containing protein Os07g0563300-like, partial [Vitis vinifera] Length = 564 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -1 Query: 407 GDARGRNQLLPRYWPQITDEELRQISG 327 GDARGRNQLLPRYWP+ITD+EL+QISG Sbjct: 283 GDARGRNQLLPRYWPRITDQELQQISG 309 >emb|CBI23327.3| unnamed protein product [Vitis vinifera] Length = 601 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -1 Query: 407 GDARGRNQLLPRYWPQITDEELRQISG 327 GDARGRNQLLPRYWP+ITD+EL+QISG Sbjct: 294 GDARGRNQLLPRYWPRITDQELQQISG 320 >gb|EOY28397.1| Transcription factor, putative isoform 1 [Theobroma cacao] Length = 905 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -1 Query: 404 DARGRNQLLPRYWPQITDEELRQISGKYPKNM*NSLPSILLFFIFGGFEC 255 D RGRNQL PRYWP+ TD++L+QISG+YP ++L+ I +EC Sbjct: 306 DGRGRNQLFPRYWPRFTDQDLQQISGEYP---------LILWGILDNWEC 346 >ref|XP_006842484.1| hypothetical protein AMTR_s00077p00082680 [Amborella trichopoda] gi|548844570|gb|ERN04159.1| hypothetical protein AMTR_s00077p00082680 [Amborella trichopoda] Length = 874 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -1 Query: 407 GDARGRNQLLPRYWPQITDEELRQISG 327 GD RGRNQLLPRYWP+ITD+EL+QISG Sbjct: 287 GDGRGRNQLLPRYWPRITDQELQQISG 313