BLASTX nr result
ID: Catharanthus23_contig00031665
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00031665 (264 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] 100 2e-19 ref|XP_006359175.1| PREDICTED: uncharacterized protein LOC102603... 99 8e-19 gb|AEI52549.1| cysteine/histidine-rich DC1 domain protein [Capsi... 95 9e-18 ref|XP_004229362.1| PREDICTED: uncharacterized protein LOC101255... 93 4e-17 ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|5... 92 7e-17 ref|XP_004229344.1| PREDICTED: uncharacterized protein LOC101249... 87 2e-15 ref|XP_006397613.1| hypothetical protein EUTSA_v10001601mg [Eutr... 87 3e-15 ref|NP_180394.1| cysteine/histidine-rich C1-like domain-containi... 87 3e-15 ref|XP_002512181.1| protein binding protein, putative [Ricinus c... 86 5e-15 ref|XP_006418664.1| hypothetical protein EUTSA_v10002650mg [Eutr... 86 7e-15 ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Caps... 85 9e-15 ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244... 85 9e-15 pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thal... 85 1e-14 ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [... 84 2e-14 ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing pr... 84 3e-14 ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing pr... 84 3e-14 ref|XP_002321892.2| hypothetical protein POPTR_0015s13530g, part... 83 3e-14 gb|EXB77335.1| hypothetical protein L484_010161 [Morus notabilis] 83 4e-14 ref|XP_006391683.1| hypothetical protein EUTSA_v10023934mg, part... 83 4e-14 ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing pr... 82 6e-14 >dbj|BAF80452.1| DC1 domain containing protein [Nicotiana tabacum] Length = 236 Score = 100 bits (250), Expect = 2e-19 Identities = 44/69 (63%), Positives = 54/69 (78%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + HFSH H L+LSE++E +EIICSGCE++LSG +Y CTKP C F LH SC ELPR+I+ Sbjct: 1 MKHFSHPHALELSEVQETNEIICSGCENKLSG--ISYKCTKPNCKFTLHKSCFELPRKIQ 58 Query: 236 HKSHPKHPL 262 H SHP HPL Sbjct: 59 HNSHPNHPL 67 >ref|XP_006359175.1| PREDICTED: uncharacterized protein LOC102603106 [Solanum tuberosum] Length = 191 Score = 98.6 bits (244), Expect = 8e-19 Identities = 46/69 (66%), Positives = 56/69 (81%), Gaps = 2/69 (2%) Frame = +2 Query: 62 HFSHRHPL-QLSEI-EENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 HFSH HPL ++S+I +E D++ICSGCEH LS AY+CTK C+FILHDSC +LPRQI+ Sbjct: 11 HFSHGHPLIKISDILDEEDQVICSGCEHHLSSE-PAYMCTKINCNFILHDSCFDLPRQIK 69 Query: 236 HKSHPKHPL 262 HKSHPKH L Sbjct: 70 HKSHPKHTL 78 >gb|AEI52549.1| cysteine/histidine-rich DC1 domain protein [Capsicum annuum] Length = 233 Score = 95.1 bits (235), Expect = 9e-18 Identities = 40/69 (57%), Positives = 54/69 (78%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + HFSH H L+LSE+++++E +CSGCE++L G ++Y CTKP C F LH SC ELPR+I+ Sbjct: 1 MKHFSHPHALELSEVQQSNETVCSGCENKLCG--TSYKCTKPNCEFSLHKSCFELPRKIQ 58 Query: 236 HKSHPKHPL 262 H SH KHPL Sbjct: 59 HNSHLKHPL 67 >ref|XP_004229362.1| PREDICTED: uncharacterized protein LOC101255237 [Solanum lycopersicum] Length = 459 Score = 92.8 bits (229), Expect = 4e-17 Identities = 43/86 (50%), Positives = 58/86 (67%) Frame = +2 Query: 5 KKPKEKEILSMEMKQLILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPT 184 +K + + I + + K L HFSH HPL+L ++++++EIICSGCE EL + Y CTK Sbjct: 207 QKEENRGITTSKSKNL--KHFSHSHPLELCKVQQSNEIICSGCEDELCDTAN-YKCTKSI 263 Query: 185 CHFILHDSCIELPRQIRHKSHPKHPL 262 C F LH SC ELP +I+H SHP HPL Sbjct: 264 CEFTLHKSCFELPEKIQHSSHPNHPL 289 >ref|XP_002330857.1| predicted protein [Populus trichocarpa] gi|566150612|ref|XP_006369466.1| DC1 domain-containing family protein [Populus trichocarpa] gi|550348015|gb|ERP66035.1| DC1 domain-containing family protein [Populus trichocarpa] Length = 190 Score = 92.0 bits (227), Expect = 7e-17 Identities = 41/67 (61%), Positives = 50/67 (74%) Frame = +2 Query: 62 HFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIRHK 241 HFSH HPL+ +++E +E ICSGCE +LSG SAY CTK TC F LH SC ELPR++ H Sbjct: 19 HFSHSHPLRPVDVKEEEESICSGCELDLSG--SAYKCTKSTCDFFLHKSCFELPRELEHT 76 Query: 242 SHPKHPL 262 SHP+H L Sbjct: 77 SHPQHLL 83 >ref|XP_004229344.1| PREDICTED: uncharacterized protein LOC101249575 [Solanum lycopersicum] Length = 236 Score = 87.0 bits (214), Expect = 2e-15 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + HFSH H L + E++E++EIICSGCE++L G + Y CTK C F LH SC ELPR+I Sbjct: 1 MKHFSHPHALAIFEVQESNEIICSGCENKLCGTTN-YKCTKSNCEFTLHKSCFELPRKIL 59 Query: 236 HKSHPKHPL 262 H SH HPL Sbjct: 60 HNSHRDHPL 68 >ref|XP_006397613.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum] gi|557098686|gb|ESQ39066.1| hypothetical protein EUTSA_v10001601mg [Eutrema salsugineum] Length = 248 Score = 86.7 bits (213), Expect = 3e-15 Identities = 39/76 (51%), Positives = 52/76 (68%) Frame = +2 Query: 35 MEMKQLILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCI 214 M K+ + H SH HPL+ + + +EIICSGCE +L+G +A+ CTK C + LH SC Sbjct: 1 MASKKPSVRHPSHSHPLRSHKAQVEEEIICSGCELDLTG--AAFKCTKSECDYFLHKSCF 58 Query: 215 ELPRQIRHKSHPKHPL 262 ELPR+ RHK+HP HPL Sbjct: 59 ELPRETRHKAHPDHPL 74 >ref|NP_180394.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis thaliana] gi|4803954|gb|AAD29826.1| unknown protein [Arabidopsis thaliana] gi|330253004|gb|AEC08098.1| cysteine/histidine-rich C1-like domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/69 (55%), Positives = 47/69 (68%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + H SH HPL++ +E DEIICSGCEH+L G A+ CTK C + LH SC +LP +I Sbjct: 11 VRHPSHNHPLRVFNSKEEDEIICSGCEHDLIG--QAFKCTKSECDYFLHKSCFDLPGEIH 68 Query: 236 HKSHPKHPL 262 HKSH HPL Sbjct: 69 HKSHTNHPL 77 >ref|XP_002512181.1| protein binding protein, putative [Ricinus communis] gi|223548725|gb|EEF50215.1| protein binding protein, putative [Ricinus communis] Length = 187 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/67 (55%), Positives = 52/67 (77%) Frame = +2 Query: 62 HFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIRHK 241 HFSH HPL+ ++++E++EIIC GCE +LSG SAY C+K C F+LH SC ELP++++H Sbjct: 18 HFSHSHPLRPADVKEDEEIICFGCELDLSG--SAYKCSKSKCVFLLHKSCFELPKELQHD 75 Query: 242 SHPKHPL 262 SH +H L Sbjct: 76 SHSEHLL 82 >ref|XP_006418664.1| hypothetical protein EUTSA_v10002650mg [Eutrema salsugineum] gi|557096592|gb|ESQ37100.1| hypothetical protein EUTSA_v10002650mg [Eutrema salsugineum] Length = 243 Score = 85.5 bits (210), Expect = 7e-15 Identities = 37/67 (55%), Positives = 48/67 (71%) Frame = +2 Query: 62 HFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIRHK 241 H SH HPL++ + +E DEIICSGCE +++G AY C K C++ LH SC +LP +I HK Sbjct: 14 HPSHNHPLRVFKSQEGDEIICSGCELDVTG--KAYKCMKKDCNYFLHKSCFDLPGEINHK 71 Query: 242 SHPKHPL 262 SHP HPL Sbjct: 72 SHPDHPL 78 >ref|XP_006298947.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] gi|482567656|gb|EOA31845.1| hypothetical protein CARUB_v10015072mg [Capsella rubella] Length = 244 Score = 85.1 bits (209), Expect = 9e-15 Identities = 37/69 (53%), Positives = 49/69 (71%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + H SH HPL+ + + DEIICSGC+ L G +++ CTK C + LH SC++LPR+IR Sbjct: 8 VRHPSHNHPLRGYKAQAEDEIICSGCDLNLIG--ASFKCTKSDCDYFLHKSCLDLPREIR 65 Query: 236 HKSHPKHPL 262 HKSHP HPL Sbjct: 66 HKSHPNHPL 74 >ref|XP_002268034.2| PREDICTED: uncharacterized protein LOC100244183 [Vitis vinifera] Length = 309 Score = 85.1 bits (209), Expect = 9e-15 Identities = 38/70 (54%), Positives = 49/70 (70%) Frame = +2 Query: 53 ILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQI 232 ++ HFSH+HPL +E++E D +CSGCE LSG SAY CT C F+LHDSC +L I Sbjct: 3 VVKHFSHKHPLCHAEVKEEDGFVCSGCELGLSG--SAYKCTISNCDFLLHDSCFKLAPVI 60 Query: 233 RHKSHPKHPL 262 + +SHP HPL Sbjct: 61 KQRSHPHHPL 70 >pir||T08861 hypothetical protein A_TM017A05.3 - Arabidopsis thaliana Length = 457 Score = 84.7 bits (208), Expect = 1e-14 Identities = 39/82 (47%), Positives = 53/82 (64%) Frame = +2 Query: 17 EKEILSMEMKQLILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFI 196 + IL + + + H SH HPL+ + + DEIICSGC+ +L G + + CTK C + Sbjct: 203 KSRILPLMASRPSVRHPSHNHPLRGHKAQVEDEIICSGCDLDLLG--AYFKCTKSECDYF 260 Query: 197 LHDSCIELPRQIRHKSHPKHPL 262 LH SC +LPR+IRHKSHP HPL Sbjct: 261 LHKSCFDLPREIRHKSHPDHPL 282 >ref|XP_004151553.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] gi|449524190|ref|XP_004169106.1| PREDICTED: probable nucleoredoxin 1-1-like [Cucumis sativus] Length = 179 Score = 84.3 bits (207), Expect = 2e-14 Identities = 37/71 (52%), Positives = 47/71 (66%) Frame = +2 Query: 50 LILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQ 229 ++ HFSH HPL + + E+D +CS CE LSG +A+ C+KP C F LHD C LP + Sbjct: 1 MLKQHFSHPHPLAAATLVEDDGTLCSACEFPLSG--AAFKCSKPKCEFHLHDLCFALPPE 58 Query: 230 IRHKSHPKHPL 262 I H SHPKHPL Sbjct: 59 IHHPSHPKHPL 69 >ref|NP_179365.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|25336186|pir||H84555 hypothetical protein At2g17740 [imported] - Arabidopsis thaliana gi|34146812|gb|AAQ62414.1| At2g17740 [Arabidopsis thaliana] gi|51968510|dbj|BAD42947.1| unknown protein [Arabidopsis thaliana] gi|51968940|dbj|BAD43162.1| unknown protein [Arabidopsis thaliana] gi|51971363|dbj|BAD44346.1| unknown protein [Arabidopsis thaliana] gi|51971715|dbj|BAD44522.1| unknown protein [Arabidopsis thaliana] gi|330251583|gb|AEC06677.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 248 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/69 (53%), Positives = 48/69 (69%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + H SH HPL+ + + DEIICSGC+ +L G + + CTK C + LH SC +LPR+IR Sbjct: 7 VRHPSHNHPLRGHKAQVEDEIICSGCDLDLLG--AYFKCTKSECDYFLHKSCFDLPREIR 64 Query: 236 HKSHPKHPL 262 HKSHP HPL Sbjct: 65 HKSHPDHPL 73 >ref|NP_181965.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128200|gb|AAC16104.1| unknown protein [Arabidopsis thaliana] gi|40822978|gb|AAR92250.1| At2g44370 [Arabidopsis thaliana] gi|45752684|gb|AAS76240.1| At2g44370 [Arabidopsis thaliana] gi|330255319|gb|AEC10413.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 250 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/76 (48%), Positives = 51/76 (67%) Frame = +2 Query: 35 MEMKQLILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCI 214 M ++ + H SH HPL+ + + +EIICSGC+ +L G +A+ CTK C + LH SC Sbjct: 1 MAARKPSVRHPSHNHPLRSHKAQVEEEIICSGCDLDLIG--AAFKCTKSECDYFLHKSCF 58 Query: 215 ELPRQIRHKSHPKHPL 262 ELPR+ RHK+HP HPL Sbjct: 59 ELPRETRHKAHPDHPL 74 >ref|XP_002321892.2| hypothetical protein POPTR_0015s13530g, partial [Populus trichocarpa] gi|550322644|gb|EEF06019.2| hypothetical protein POPTR_0015s13530g, partial [Populus trichocarpa] Length = 311 Score = 83.2 bits (204), Expect = 3e-14 Identities = 38/77 (49%), Positives = 49/77 (63%), Gaps = 1/77 (1%) Frame = +2 Query: 29 LSMEMK-QLILHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHD 205 L ME + Q HHFSH HPL+L+EI+ +DEI+CS C+ S G Y+C C F LH+ Sbjct: 194 LFMESRGQQQFHHFSHGHPLKLTEIKHDDEILCSACQKHCS--GQTYVCCSNKCKFFLHN 251 Query: 206 SCIELPRQIRHKSHPKH 256 SC LP++I H HP H Sbjct: 252 SCFNLPQKIHHPFHPHH 268 >gb|EXB77335.1| hypothetical protein L484_010161 [Morus notabilis] Length = 213 Score = 82.8 bits (203), Expect = 4e-14 Identities = 42/92 (45%), Positives = 52/92 (56%), Gaps = 21/92 (22%) Frame = +2 Query: 50 LILHHFSHRHPLQLSEIE--------------------ENDEI-ICSGCEHELSGGGSAY 166 +++ HFSH HPL ++E +D+I ICSGCE EL G SAY Sbjct: 1 MMITHFSHHHPLSPYQVELDHHDHHQKHDDQDHDHDHDHDDQITICSGCELELISGSSAY 60 Query: 167 ICTKPTCHFILHDSCIELPRQIRHKSHPKHPL 262 C KP C F LH+ C ELPR+ RH SHP+HPL Sbjct: 61 KCNKPGCDFRLHELCSELPRESRHPSHPQHPL 92 >ref|XP_006391683.1| hypothetical protein EUTSA_v10023934mg, partial [Eutrema salsugineum] gi|557088189|gb|ESQ28969.1| hypothetical protein EUTSA_v10023934mg, partial [Eutrema salsugineum] Length = 183 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/67 (55%), Positives = 46/67 (68%) Frame = +2 Query: 62 HFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIRHK 241 H SH HPL + + +E DEIICSGCE +L+G A+ C K C + LH SC +LP +I HK Sbjct: 14 HPSHNHPLWVFKSQEEDEIICSGCELDLTG--QAFKCMKKDCDYFLHKSCFDLPGEITHK 71 Query: 242 SHPKHPL 262 SHP HPL Sbjct: 72 SHPDHPL 78 >ref|NP_181966.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] gi|3128201|gb|AAC16105.1| unknown protein [Arabidopsis thaliana] gi|37202108|gb|AAQ89669.1| At2g44380 [Arabidopsis thaliana] gi|51971661|dbj|BAD44495.1| unknown protein [Arabidopsis thaliana] gi|330255320|gb|AEC10414.1| cysteine/histidine-rich C1 domain-containing protein [Arabidopsis thaliana] Length = 247 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/69 (49%), Positives = 46/69 (66%) Frame = +2 Query: 56 LHHFSHRHPLQLSEIEENDEIICSGCEHELSGGGSAYICTKPTCHFILHDSCIELPRQIR 235 + H SH HPL++ + + DE++CSGCE EL+G A+ C K C + LH SC +LPR+ Sbjct: 12 VRHASHNHPLRVFKARDEDEVVCSGCELELTG--QAFKCMKSDCDYFLHKSCFDLPRETN 69 Query: 236 HKSHPKHPL 262 HKSHP H L Sbjct: 70 HKSHPNHSL 78