BLASTX nr result
ID: Catharanthus23_contig00031458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00031458 (502 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006429592.1| hypothetical protein CICLE_v10013263mg [Citr... 56 6e-06 >ref|XP_006429592.1| hypothetical protein CICLE_v10013263mg [Citrus clementina] gi|557531649|gb|ESR42832.1| hypothetical protein CICLE_v10013263mg [Citrus clementina] Length = 73 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/63 (39%), Positives = 38/63 (60%) Frame = -3 Query: 428 GNQPLFYYYHKDGGGRDRSKNNEEAFSGCGCGPCWIVSSGLKMVRRCLFVSCYPVLQCFG 249 GN + ++H G ++ F C C PC++VSS +RRC+FV+CYP+L+CFG Sbjct: 2 GNDHHYNHHHHHHG----DSPYDDPFLRCCCCPCFMVSSIFTGIRRCIFVACYPLLRCFG 57 Query: 248 WDE 240 D+ Sbjct: 58 LDD 60