BLASTX nr result
ID: Catharanthus23_contig00031272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00031272 (563 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004252755.1| PREDICTED: soyasapogenol B glucuronide galac... 47 3e-06 ref|XP_004252756.1| PREDICTED: soyasapogenol B glucuronide galac... 47 3e-06 ref|XP_004252757.1| PREDICTED: soyasapogenol B glucuronide galac... 47 3e-06 >ref|XP_004252755.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like isoform 1 [Solanum lycopersicum] Length = 489 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +3 Query: 165 LITQEQSKVLYICFGSLAKLSETQLKEICF---SS*GFGLPIYLGYNEPRKNEQD*WL 329 L +QE + V+YICFGS+ + S+ QL EI F +S L + NEP++NEQ+ W+ Sbjct: 273 LDSQEPNSVVYICFGSMGRFSDAQLTEIAFALEASNSSFLWVVRKGNEPQENEQENWM 330 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 6/34 (17%) Frame = +2 Query: 350 SRKGLFIRNWAP------HPS*RF*TISTHCGWN 433 + KGL +R W P HP+ THCGWN Sbjct: 341 NNKGLLVRGWVPQLKILNHPATG--AFMTHCGWN 372 >ref|XP_004252756.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like isoform 2 [Solanum lycopersicum] Length = 396 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +3 Query: 165 LITQEQSKVLYICFGSLAKLSETQLKEICF---SS*GFGLPIYLGYNEPRKNEQD*WL 329 L +QE + V+YICFGS+ + S+ QL EI F +S L + NEP++NEQ+ W+ Sbjct: 180 LDSQEPNSVVYICFGSMGRFSDAQLTEIAFALEASNSSFLWVVRKGNEPQENEQENWM 237 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 6/34 (17%) Frame = +2 Query: 350 SRKGLFIRNWAP------HPS*RF*TISTHCGWN 433 + KGL +R W P HP+ THCGWN Sbjct: 248 NNKGLLVRGWVPQLKILNHPATG--AFMTHCGWN 279 >ref|XP_004252757.1| PREDICTED: soyasapogenol B glucuronide galactosyltransferase-like isoform 3 [Solanum lycopersicum] Length = 340 Score = 47.0 bits (110), Expect(2) = 3e-06 Identities = 25/58 (43%), Positives = 37/58 (63%), Gaps = 3/58 (5%) Frame = +3 Query: 165 LITQEQSKVLYICFGSLAKLSETQLKEICF---SS*GFGLPIYLGYNEPRKNEQD*WL 329 L +QE + V+YICFGS+ + S+ QL EI F +S L + NEP++NEQ+ W+ Sbjct: 124 LDSQEPNSVVYICFGSMGRFSDAQLTEIAFALEASNSSFLWVVRKGNEPQENEQENWM 181 Score = 30.0 bits (66), Expect(2) = 3e-06 Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 6/34 (17%) Frame = +2 Query: 350 SRKGLFIRNWAP------HPS*RF*TISTHCGWN 433 + KGL +R W P HP+ THCGWN Sbjct: 192 NNKGLLVRGWVPQLKILNHPATG--AFMTHCGWN 223