BLASTX nr result
ID: Catharanthus23_contig00031159
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00031159 (254 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316593.1| hypothetical protein POPTR_0011s00810g [Popu... 55 1e-05 >ref|XP_002316593.1| hypothetical protein POPTR_0011s00810g [Populus trichocarpa] gi|118487888|gb|ABK95766.1| unknown [Populus trichocarpa] gi|222859658|gb|EEE97205.1| hypothetical protein POPTR_0011s00810g [Populus trichocarpa] Length = 256 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/49 (57%), Positives = 33/49 (67%) Frame = +1 Query: 1 RKAIEERTLLKRLGTREDMXXXXXXXXXXXXXXITGETLVIAGGIPSRL 147 RK IE++TLLKRLGT +DM ITGETLV+AGG+PSRL Sbjct: 208 RKTIEDQTLLKRLGTTDDMASAVAFLASDDASYITGETLVVAGGMPSRL 256