BLASTX nr result
ID: Catharanthus23_contig00029983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029983 (358 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EAZ37852.1| hypothetical protein OsJ_22198 [Oryza sativa Japo... 57 3e-06 >gb|EAZ37852.1| hypothetical protein OsJ_22198 [Oryza sativa Japonica Group] Length = 446 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/52 (42%), Positives = 34/52 (65%) Frame = +1 Query: 16 PKVKIFLWRMYHSILPMRKNLSRRIISIPSGCVICPERVEDVLHIFFRRRTA 171 PK+KIF WRM H ++P + L+ + I++ GC +CP VED+ H+ F + A Sbjct: 259 PKIKIFAWRMLHGVIPCKGILADKHIAVQGGCPVCPSGVEDIKHMVFTCKRA 310