BLASTX nr result
ID: Catharanthus23_contig00029752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00029752 (344 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-06 gb|ESW15257.1| hypothetical protein PHAVU_007G057700g [Phaseolus... 58 1e-06 gb|EOY10376.1| Tetratricopeptide repeat (TPR)-like superfamily p... 58 1e-06 gb|EXC74564.1| hypothetical protein L484_000327 [Morus notabilis] 57 2e-06 gb|EXC01816.1| hypothetical protein L484_021456 [Morus notabilis] 57 2e-06 gb|EXB63452.1| hypothetical protein L484_005415 [Morus notabilis] 57 2e-06 ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|EPS73044.1| hypothetical protein M569_01710 [Genlisea aurea] 57 3e-06 ref|XP_004954668.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006340539.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006841418.1| hypothetical protein AMTR_s00003p00032470 [A... 57 3e-06 ref|XP_004296377.1| PREDICTED: putative pentatricopeptide repeat... 57 3e-06 gb|EMJ26204.1| hypothetical protein PRUPE_ppa020300mg [Prunus pe... 57 3e-06 ref|XP_004231485.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004157540.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_004142406.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006841563.1| hypothetical protein AMTR_s00003p00182540 [A... 56 4e-06 gb|EOY29048.1| Tetratricopeptide repeat-like superfamily protein... 56 4e-06 >ref|XP_006354721.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Solanum tuberosum] Length = 786 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/39 (64%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS D RFHHFKG CSCRDYW Sbjct: 748 DCHSAIKFISKLVGREIILRDATRFHHFKGGFCSCRDYW 786 >gb|ESW15257.1| hypothetical protein PHAVU_007G057700g [Phaseolus vulgaris] Length = 685 Score = 58.2 bits (139), Expect = 1e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS DN RFHHFK CSC+DYW Sbjct: 647 DCHSAIKFISKIVGREIIVRDNNRFHHFKNGWCSCKDYW 685 >gb|EOY10376.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 720 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+AIKF+S DN RFHHFK +CSCRDYW Sbjct: 682 DCHTAIKFMSKISQREIIVRDNSRFHHFKDGKCSCRDYW 720 >gb|EXC74564.1| hypothetical protein L484_000327 [Morus notabilis] Length = 590 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+AIKFIS DN RFHHF G +CSC DYW Sbjct: 552 DCHTAIKFISKIVGREIIVRDNSRFHHFNGGQCSCGDYW 590 >gb|EXC01816.1| hypothetical protein L484_021456 [Morus notabilis] Length = 709 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+AIKFIS DN RFHHF G +CSC DYW Sbjct: 671 DCHTAIKFISKIVGREIIVRDNSRFHHFNGGQCSCGDYW 709 >gb|EXB63452.1| hypothetical protein L484_005415 [Morus notabilis] Length = 678 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS DN RFH FK +CSCRDYW Sbjct: 640 DCHSAIKFISGIVGREIIVRDNNRFHQFKDGKCSCRDYW 678 >ref|XP_006342693.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum tuberosum] Length = 628 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH A KFIS D RFHHFKG ECSC+DYW Sbjct: 590 DCHQASKFISKVYDREIIVRDRNRFHHFKGGECSCKDYW 628 >ref|XP_004253185.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Solanum lycopersicum] Length = 626 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH A KFIS D RFHHFKG ECSC+DYW Sbjct: 588 DCHQASKFISKVYNLEIIVRDRNRFHHFKGGECSCKDYW 626 >gb|EPS73044.1| hypothetical protein M569_01710 [Genlisea aurea] Length = 684 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/39 (56%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKF+S DN R+HHF+ N CSC DYW Sbjct: 646 DCHSAIKFVSGIVEREIVVRDNNRYHHFRDNRCSCGDYW 684 >ref|XP_004954668.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Setaria italica] Length = 691 Score = 57.0 bits (136), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH A KFIS DN RFHHFK ECSC+DYW Sbjct: 653 DCHRAFKFISAIVGREIIVRDNNRFHHFKNYECSCKDYW 691 >ref|XP_006340539.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Solanum tuberosum] Length = 687 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS DN RFH FK +CSCRDYW Sbjct: 649 DCHSAIKFISGITGREIIVRDNNRFHSFKDYQCSCRDYW 687 >ref|XP_006841418.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda] gi|548843439|gb|ERN03093.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda] Length = 791 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+A+KF+S D +RFHHFK ECSCRDYW Sbjct: 753 DCHTAMKFMSKVVEREIIVRDGKRFHHFKHGECSCRDYW 791 >ref|XP_004296377.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330-like [Fragaria vesca subsp. vesca] Length = 693 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/39 (58%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+A K IS DN RFHHFKG ECSC DYW Sbjct: 655 DCHTATKLISKIVGREIIVRDNNRFHHFKGGECSCGDYW 693 >gb|EMJ26204.1| hypothetical protein PRUPE_ppa020300mg [Prunus persica] Length = 671 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/39 (58%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+AIKF+S DN RFHHFK ECSC DYW Sbjct: 633 DCHAAIKFMSKIVGREMIVRDNSRFHHFKDGECSCGDYW 671 >ref|XP_004231485.1| PREDICTED: pentatricopeptide repeat-containing protein At4g14850-like [Solanum lycopersicum] Length = 687 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 25/39 (64%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS DN RFH FK +CSCRDYW Sbjct: 649 DCHSAIKFISGITGREIVVRDNNRFHSFKDYQCSCRDYW 687 >ref|XP_004157540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Cucumis sativus] Length = 782 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS D RFHHFK CSCRDYW Sbjct: 744 DCHSAIKFISKLVGREIIVRDATRFHHFKDGSCSCRDYW 782 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+AIKF+S D +RFHHFK ECSCR+YW Sbjct: 759 DCHNAIKFMSKVVGREIVVRDGKRFHHFKNGECSCRNYW 797 >ref|XP_004142406.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Cucumis sativus] Length = 782 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKFIS D RFHHFK CSCRDYW Sbjct: 744 DCHSAIKFISKLVGREIIVRDATRFHHFKDGSCSCRDYW 782 >ref|XP_006841563.1| hypothetical protein AMTR_s00003p00182540 [Amborella trichopoda] gi|548843584|gb|ERN03238.1| hypothetical protein AMTR_s00003p00182540 [Amborella trichopoda] Length = 689 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCH+A+KF+S D +RFHHFK ECSCRDYW Sbjct: 651 DCHTAMKFMSKVVEREIIVRDGKRFHHFKYGECSCRDYW 689 >gb|EOY29048.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781793|gb|EOY29049.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] gi|508781794|gb|EOY29050.1| Tetratricopeptide repeat-like superfamily protein isoform 1 [Theobroma cacao] Length = 675 Score = 56.2 bits (134), Expect = 4e-06 Identities = 22/39 (56%), Positives = 24/39 (61%) Frame = +3 Query: 3 DCHSAIKFISXXXXXXXXXXDNRRFHHFKGNECSCRDYW 119 DCHSAIKF+S D RFHHF+G CSC DYW Sbjct: 637 DCHSAIKFVSQVVRREIIVRDTNRFHHFRGGSCSCGDYW 675