BLASTX nr result
ID: Catharanthus23_contig00026626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00026626 (684 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ28079.1| hypothetical protein PRUPE_ppa016713mg [Prunus pe... 65 2e-08 gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] 61 4e-07 ref|XP_002517182.1| conserved hypothetical protein [Ricinus comm... 60 6e-07 ref|XP_006489317.1| PREDICTED: uncharacterized protein LOC102609... 59 1e-06 ref|XP_006380064.1| hypothetical protein POPTR_0008s20830g, part... 58 2e-06 >gb|EMJ28079.1| hypothetical protein PRUPE_ppa016713mg [Prunus persica] Length = 66 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +1 Query: 85 MRDRAKINAMRSGVVVLGALAFGYLTLELGFRPF 186 MR+R K+NAMRSGVVVLGALAFGYLTL+LGFRPF Sbjct: 1 MRERTKVNAMRSGVVVLGALAFGYLTLQLGFRPF 34 >gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] Length = 64 Score = 60.8 bits (146), Expect = 4e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 85 MRDRAKINAMRSGVVVLGALAFGYLTLELGFRPF 186 MRDR K+NAMRSGVVV+GA+AFGYLTL LGF+PF Sbjct: 1 MRDRRKMNAMRSGVVVVGAMAFGYLTLYLGFKPF 34 >ref|XP_002517182.1| conserved hypothetical protein [Ricinus communis] gi|223543817|gb|EEF45345.1| conserved hypothetical protein [Ricinus communis] Length = 244 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +1 Query: 73 RQRRMRDRAKINAMRSGVVVLGALAFGYLTLELGFRPF 186 R++RM + K+NA+RSG+VV+GALAFGYLT E+GF+PF Sbjct: 10 RRKRMNPQTKLNAIRSGIVVIGALAFGYLTFEIGFKPF 47 >ref|XP_006489317.1| PREDICTED: uncharacterized protein LOC102609245 [Citrus sinensis] Length = 62 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/34 (76%), Positives = 33/34 (97%) Frame = +1 Query: 85 MRDRAKINAMRSGVVVLGALAFGYLTLELGFRPF 186 MR+RAK+NA+RSG+VV+G LAFGYL+LELGF+PF Sbjct: 1 MRERAKMNAIRSGIVVVGFLAFGYLSLELGFKPF 34 >ref|XP_006380064.1| hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] gi|550333563|gb|ERP57861.1| hypothetical protein POPTR_0008s20830g, partial [Populus trichocarpa] Length = 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/54 (50%), Positives = 42/54 (77%) Frame = +1 Query: 25 RLTTEGESQQ*IESRGRQRRMRDRAKINAMRSGVVVLGALAFGYLTLELGFRPF 186 R + EG ++ + +G++ M+ K+NA+RSG+VV+GALAFGYLTL++GF+PF Sbjct: 10 RKSGEGREEERRQVKGKES-MKAEDKLNAIRSGIVVIGALAFGYLTLQIGFKPF 62