BLASTX nr result
ID: Catharanthus23_contig00026241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00026241 (780 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMJ06218.1| hypothetical protein PRUPE_ppa003794mg [Prunus pe... 57 5e-06 ref|XP_004237473.1| PREDICTED: uncharacterized protein LOC101260... 57 5e-06 gb|EPS71232.1| hypothetical protein M569_03524, partial [Genlise... 57 9e-06 >gb|EMJ06218.1| hypothetical protein PRUPE_ppa003794mg [Prunus persica] Length = 548 Score = 57.4 bits (137), Expect = 5e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +2 Query: 272 ASSSTENSSAPVRIVALVGEGSISPMKSTPWFDVMIHTVSK 394 A + TE+ S PVRIVALVG+G++SP+K+TPW +VM+HT + Sbjct: 70 AGAVTESESKPVRIVALVGQGTLSPLKATPWEEVMLHTAKR 110 >ref|XP_004237473.1| PREDICTED: uncharacterized protein LOC101260129 [Solanum lycopersicum] Length = 534 Score = 57.4 bits (137), Expect = 5e-06 Identities = 26/49 (53%), Positives = 32/49 (65%), Gaps = 3/49 (6%) Frame = +2 Query: 257 GGAITAS---SSTENSSAPVRIVALVGEGSISPMKSTPWFDVMIHTVSK 394 GG I + E PVRIV +VGEGS+SP+KSTPW DVM+HT + Sbjct: 53 GGRIVGAVEMDKAEEKRGPVRIVGIVGEGSVSPLKSTPWLDVMLHTAER 101 >gb|EPS71232.1| hypothetical protein M569_03524, partial [Genlisea aurea] Length = 449 Score = 56.6 bits (135), Expect = 9e-06 Identities = 23/32 (71%), Positives = 29/32 (90%) Frame = +2 Query: 299 APVRIVALVGEGSISPMKSTPWFDVMIHTVSK 394 APV+IVA+VG GS+SP+KSTPW+DVM+HT K Sbjct: 2 APVKIVAIVGAGSVSPIKSTPWYDVMLHTAKK 33