BLASTX nr result
ID: Catharanthus23_contig00026073
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Catharanthus23_contig00026073 (372 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB41474.1| cytochrome P450 [Catharanthus roseus] 60 2e-07 >emb|CAB41474.1| cytochrome P450 [Catharanthus roseus] Length = 501 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = +3 Query: 3 SDKRRTISLSSNKFVAFSLGLRICSGKELGLNRVKAAAATIIQNNDIQTKKNYP 164 SDK + I + +NKF+AF G RIC GKELGLNRVKA AA II + +N P Sbjct: 425 SDKGKLIPVQTNKFLAFGTGPRICPGKELGLNRVKAVAAAIIPKYSFKIMRNKP 478